(data stored in ACNUC7421 zone)

EMBL: CP000675.PE761

CP000675.PE761       Location/Qualifiers
FT   CDS             complement(826979..827443)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPC_2627"
FT                   /product="putative transmembrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_2627"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ56542"
FT                   /protein_id="ABQ56542.1"
FT                   /translation="MKALIAKTYLLADKIFDFLAPIFILLTRLYLAQVFFLSGLTKISN
FT                   WQATLSLFQNEYMVPVMSPTLAAYLGTACELGFPVLITLGLGSRLVLFGLFLFNLFAVF
FT                   SYQFLWTPDGAVGLTDHMQWGIMILMLLCTGPGKLSIDYLIRRFYLKLDN"
     MKALIAKTYL LADKIFDFLA PIFILLTRLY LAQVFFLSGL TKISNWQATL SLFQNEYMVP        60
     VMSPTLAAYL GTACELGFPV LITLGLGSRL VLFGLFLFNL FAVFSYQFLW TPDGAVGLTD       120
     HMQWGIMILM LLCTGPGKLS IDYLIRRFYL KLDN                                   154
//

If you have problems or comments...

PBIL Back to PBIL home page