(data stored in ACNUC7421 zone)

EMBL: CP000675.PE762

CP000675.PE762       Location/Qualifiers
FT   CDS             complement(827440..828003)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPC_2626"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_2626"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ56541"
FT                   /protein_id="ABQ56541.1"
FT                   /translation="MHRYINNCESTQYDINQYGDSLPQFIANFEPAKELPYLQQLCAIE
FT                   WHWHTLKLLSPVNPFDFEAFSSIDEISFQSLCFHLTPNLKILCSEYPIYQIWAMNYFQQ
FT                   DKQIQISGCPEKVVIYQHNDLPCIMLISEEEYIFLELLSSGNQTPWQKVVTELSKWISE
FT                   EKIGDTLTKALRYQWINHFSLEAI"
     MHRYINNCES TQYDINQYGD SLPQFIANFE PAKELPYLQQ LCAIEWHWHT LKLLSPVNPF        60
     DFEAFSSIDE ISFQSLCFHL TPNLKILCSE YPIYQIWAMN YFQQDKQIQI SGCPEKVVIY       120
     QHNDLPCIML ISEEEYIFLE LLSSGNQTPW QKVVTELSKW ISEEKIGDTL TKALRYQWIN       180
     HFSLEAI                                                                 187
//

If you have problems or comments...

PBIL Back to PBIL home page