(data stored in ACNUC7421 zone)

EMBL: CP000675.PE765

CP000675.PE765       Location/Qualifiers
FT   CDS             829678..830703
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPC_2623"
FT                   /product="conserved hypothetical protein; RssA, Predicted
FT                   esterase of the alpha-beta hydrolase superfamily"
FT                   /note="COG1752"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_2623"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ56538"
FT                   /protein_id="ABQ56538.1"
FT                   /translation="MAKDTKIINLALQGGGAHGALAWGIIDRLLEDGRIHFDAISATSA
FT                   GAMNAAVLAYGFATGGKEGAREALHQFWKMVSDAGQIYNPLKKTPLEELLGIGIENSMS
FT                   FFMFDLMTKILSPYQFNPLNFNPLKEILEQIVDFEKIKSCKSIKIFISATNVRTGKINV
FT                   FDNKKISADAVMASACLPFMFQAVNIGEDYFWDGGYMGNPAIFPLIYNSECRDILILHI
FT                   NPIYREHVPDTAAEILNRVNEISFNSSLMREMRAIAFVTKLIDSGWIKDEYKNNLRKLY
FT                   LHAIRADVSMESSSVASKLNPEWSFISHLYEEGRKKGEEWLKSNFKHLGKMTSIDLDEY
FT                   L"
     MAKDTKIINL ALQGGGAHGA LAWGIIDRLL EDGRIHFDAI SATSAGAMNA AVLAYGFATG        60
     GKEGAREALH QFWKMVSDAG QIYNPLKKTP LEELLGIGIE NSMSFFMFDL MTKILSPYQF       120
     NPLNFNPLKE ILEQIVDFEK IKSCKSIKIF ISATNVRTGK INVFDNKKIS ADAVMASACL       180
     PFMFQAVNIG EDYFWDGGYM GNPAIFPLIY NSECRDILIL HINPIYREHV PDTAAEILNR       240
     VNEISFNSSL MREMRAIAFV TKLIDSGWIK DEYKNNLRKL YLHAIRADVS MESSSVASKL       300
     NPEWSFISHL YEEGRKKGEE WLKSNFKHLG KMTSIDLDEY L                           341
//

If you have problems or comments...

PBIL Back to PBIL home page