(data stored in ACNUC7421 zone)

EMBL: CP000675.PE768

CP000675.PE768       Location/Qualifiers
FT   CDS             833879..834151
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPC_2620"
FT                   /product="signal peptide protein"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_2620"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ56535"
FT                   /protein_id="ABQ56535.1"
FT                   /translation="MNKRPIQNTAVIAAALGAALASIYTYTDWLSSDEITVKRERCYNV
FT                   ARAGKNDCATSQHSCAAQSTADRDPEAFIMLPKGLCERIVGGRSG"
     MNKRPIQNTA VIAAALGAAL ASIYTYTDWL SSDEITVKRE RCYNVARAGK NDCATSQHSC        60
     AAQSTADRDP EAFIMLPKGL CERIVGGRSG                                         90
//

If you have problems or comments...

PBIL Back to PBIL home page