(data stored in ACNUC7421 zone)

EMBL: CP000675.PE77

CP000675.PE77        Location/Qualifiers
FT   CDS             complement(74470..75741)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPC_0077"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_0077"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ54077"
FT                   /protein_id="ABQ54077.1"
FT                   /translation="MKTINPVFFELVDKLSPDNKFAMYLVDYGYGDLVGDDDGIFLPTK
FT                   TGQYVRLDSEYTPPSMLNDLAYGLSNSPLGMFFNKSFEWFLNTSDEQINRTFPIYIDPP
FT                   GTFFSIGHIINYGYTATHLPNGVLFVTAGSKSNFMIPKIGCGIMHSRIQKNHNITKSAP
FT                   RSYHEHADIFQDIVKGNRDNNGWSASVLYFSENWIEKISKDSAWQEVRDYFYRISNHRS
FT                   EYAVNSDYYNHVYRVTNKRNNLKSNLLIYETARHLFEILLGAKLGFAPAMDDELLPLSI
FT                   IQEVYSECYKLEYLPIIAIPAYYNYRDPKPVYYSLQYPSLCSYSPKARNASTTLSDLIA
FT                   LIDVVHKYQKDFTLPIRECKNTILEEVSKITSFNFYHPATEENSIIKSPEIIPYQDERF
FT                   RGEKRFPINASFFKGCVSIFSNSI"
     MKTINPVFFE LVDKLSPDNK FAMYLVDYGY GDLVGDDDGI FLPTKTGQYV RLDSEYTPPS        60
     MLNDLAYGLS NSPLGMFFNK SFEWFLNTSD EQINRTFPIY IDPPGTFFSI GHIINYGYTA       120
     THLPNGVLFV TAGSKSNFMI PKIGCGIMHS RIQKNHNITK SAPRSYHEHA DIFQDIVKGN       180
     RDNNGWSASV LYFSENWIEK ISKDSAWQEV RDYFYRISNH RSEYAVNSDY YNHVYRVTNK       240
     RNNLKSNLLI YETARHLFEI LLGAKLGFAP AMDDELLPLS IIQEVYSECY KLEYLPIIAI       300
     PAYYNYRDPK PVYYSLQYPS LCSYSPKARN ASTTLSDLIA LIDVVHKYQK DFTLPIRECK       360
     NTILEEVSKI TSFNFYHPAT EENSIIKSPE IIPYQDERFR GEKRFPINAS FFKGCVSIFS       420
     NSI                                                                     423
//

If you have problems or comments...

PBIL Back to PBIL home page