(data stored in ACNUC7421 zone)

EMBL: CP000675.PE771

CP000675.PE771       Location/Qualifiers
FT   CDS             complement(836279..837112)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPC_2617"
FT                   /product="Hypothetical UPF0276 protein"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_2617"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ56532"
FT                   /protein_id="ABQ56532.1"
FT                   /translation="MHKIINGAMTGIGLRAPHYAQILEEKPDIDWLEVHTENFLVKGGP
FT                   LLELLDSISQHYPLSFHGVGLSLGSAEGVCIAHLNRIKTLIDRFQPALLSDHLSWSTIG
FT                   NTYLPDLLPIPYNEESLTIISNNIDRVQNYLKRTLLIENPSSYLEYQTSSYSEPDFLAE
FT                   IIKRTEARLLLDINNIYVSCSNNKRDPYQYIQRIPHEAVQEIHLAGHSIAYQDNTNFLL
FT                   IDTHNNYVCPEVWDLYRYAIHYTGLVPTLLEWDTEIPSLDTLLNEARKSACYAYN"
     MHKIINGAMT GIGLRAPHYA QILEEKPDID WLEVHTENFL VKGGPLLELL DSISQHYPLS        60
     FHGVGLSLGS AEGVCIAHLN RIKTLIDRFQ PALLSDHLSW STIGNTYLPD LLPIPYNEES       120
     LTIISNNIDR VQNYLKRTLL IENPSSYLEY QTSSYSEPDF LAEIIKRTEA RLLLDINNIY       180
     VSCSNNKRDP YQYIQRIPHE AVQEIHLAGH SIAYQDNTNF LLIDTHNNYV CPEVWDLYRY       240
     AIHYTGLVPT LLEWDTEIPS LDTLLNEARK SACYAYN                                277
//

If you have problems or comments...

PBIL Back to PBIL home page