(data stored in ACNUC7421 zone)

EMBL: CP000675.PE777

CP000675.PE777       Location/Qualifiers
FT   CDS             843663..844589
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPC_2611"
FT                   /product="ABC transporter ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_2611"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ56526"
FT                   /protein_id="ABQ56526.1"
FT                   /translation="MSKWSSKQIIIDVSGLAKSFNGINAVVNLNLQIEEGTIFGFLGPN
FT                   GSGKTTSLRLLSGLIIPDKGQGRCLNLDLMTQTKLIQAQIGYMPQNFCLYQNLTVYENL
FT                   DFIARIYQLKNRKERLKEIIELLALSDNQKRITATLSGGWKQRVALAAALLHKPRILLL
FT                   DEPTSGIDPQSRLLIWAHIQSIVSKGVTVLLSTQHMDEAERCHQLVYMSAGEIIARGSV
FT                   IEIIQSTGLHSWVVKGESFSRLKDILVNNPAIQMIEKGNEMRISSIVDDIHQVLDPFVL
FT                   NNYEIKKTDTTLEDAFIYKIMKEGNPK"
     MSKWSSKQII IDVSGLAKSF NGINAVVNLN LQIEEGTIFG FLGPNGSGKT TSLRLLSGLI        60
     IPDKGQGRCL NLDLMTQTKL IQAQIGYMPQ NFCLYQNLTV YENLDFIARI YQLKNRKERL       120
     KEIIELLALS DNQKRITATL SGGWKQRVAL AAALLHKPRI LLLDEPTSGI DPQSRLLIWA       180
     HIQSIVSKGV TVLLSTQHMD EAERCHQLVY MSAGEIIARG SVIEIIQSTG LHSWVVKGES       240
     FSRLKDILVN NPAIQMIEKG NEMRISSIVD DIHQVLDPFV LNNYEIKKTD TTLEDAFIYK       300
     IMKEGNPK                                                                308
//

If you have problems or comments...

PBIL Back to PBIL home page