(data stored in ACNUC7421 zone)

EMBL: CP000675.PE778

CP000675.PE778       Location/Qualifiers
FT   CDS             844604..845722
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPC_2610"
FT                   /product="transmembrane protein, ABC-type multidrug
FT                   transport system"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_2610"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ56525"
FT                   /protein_id="ABQ56525.1"
FT                   /translation="MQRLWAIIRKEFLLMKRDPATIVIMAILPLILVCIAGYAINTYPQ
FT                   KVPTVLINLDNTDVTRELVREIQNTGYFSFVASTNDSESAHHLLKTGKAILVLTIPVNF
FT                   TKAIRRNQNPALLLEDGSIDAIASGRAIIALAGLKSSFIEKMGQKGINIPLQRPDFQII
FT                   NHRLYDPDRVTQFYVVPGMIGLVLMLTMLLITVVVAFRDVQGGTIEYLLASPTRPSEVL
FT                   LGEIFSYILIGYLQLSLGLILSYYLFHVPFIGAPLLLYLCTLPYIVAELSLGLTIATFC
FT                   TSQFEAVQVINVFIAFSILLTGFTFPIFGMPEWAQYLGLFLPLTHFFKIMFGIMLKGNN
FT                   FGEIWANLWPLLAYCLTMISLATWRFKRHFVR"
     MQRLWAIIRK EFLLMKRDPA TIVIMAILPL ILVCIAGYAI NTYPQKVPTV LINLDNTDVT        60
     RELVREIQNT GYFSFVASTN DSESAHHLLK TGKAILVLTI PVNFTKAIRR NQNPALLLED       120
     GSIDAIASGR AIIALAGLKS SFIEKMGQKG INIPLQRPDF QIINHRLYDP DRVTQFYVVP       180
     GMIGLVLMLT MLLITVVVAF RDVQGGTIEY LLASPTRPSE VLLGEIFSYI LIGYLQLSLG       240
     LILSYYLFHV PFIGAPLLLY LCTLPYIVAE LSLGLTIATF CTSQFEAVQV INVFIAFSIL       300
     LTGFTFPIFG MPEWAQYLGL FLPLTHFFKI MFGIMLKGNN FGEIWANLWP LLAYCLTMIS       360
     LATWRFKRHF VR                                                           372
//

If you have problems or comments...

PBIL Back to PBIL home page