(data stored in ACNUC7421 zone)

EMBL: CP000675.PE783

CP000675.PE783       Location/Qualifiers
FT   CDS             851234..851674
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPC_2605"
FT                   /product="DNA binding stress protein"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_2605"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ56520"
FT                   /protein_id="ABQ56520.1"
FT                   /translation="MSKVIKKLEVALADTYALYLKTQNYHWHVTGPQFKSLHELFEIQY
FT                   KELAEAVDQIAERIRIMGHKAPATFAEFNQLKTIKDGDSGLSANEMVSELAKDNMMIVK
FT                   DLNQAIKIAQENEDEGTVTILSDRVAAHEKAHWMLSASKEKK"
     MSKVIKKLEV ALADTYALYL KTQNYHWHVT GPQFKSLHEL FEIQYKELAE AVDQIAERIR        60
     IMGHKAPATF AEFNQLKTIK DGDSGLSANE MVSELAKDNM MIVKDLNQAI KIAQENEDEG       120
     TVTILSDRVA AHEKAHWMLS ASKEKK                                            146
//

If you have problems or comments...

PBIL Back to PBIL home page