(data stored in ACNUC7421 zone)

EMBL: CP000675.PE79

CP000675.PE79        Location/Qualifiers
FT   CDS             77278..78204
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPC_0079"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_0079"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ54079"
FT                   /protein_id="ABQ54079.1"
FT                   /translation="MNSLKNEYYIRAPKEKDFQNYNGKELKKIHLFMNKIYHQILFGDK
FT                   PIDNKVFHEFKKYESSWMANEKNYFLTKYDCNVIVKDESLVRDVLQKHEVFNHPIFDYL
FT                   MHDASIEDLKKFAYSESIMNLEFFDYLALAVIGVSDQAKVEIMANLWDEAGQGCAEKFH
FT                   TVLFQNFLNDLGITYDRKQILEGLSWEGVAGINLFNYFSIYPFNKTKYFGMLAATEMLD
FT                   PPHYNKLIKGIMRIFSSHNIDYSYYTEHELVDAHHASGWLNHVVIPELARKPYKTQDFW
FT                   LGFYMRLDSTKKYYDQLLNSLIMKKAA"
     MNSLKNEYYI RAPKEKDFQN YNGKELKKIH LFMNKIYHQI LFGDKPIDNK VFHEFKKYES        60
     SWMANEKNYF LTKYDCNVIV KDESLVRDVL QKHEVFNHPI FDYLMHDASI EDLKKFAYSE       120
     SIMNLEFFDY LALAVIGVSD QAKVEIMANL WDEAGQGCAE KFHTVLFQNF LNDLGITYDR       180
     KQILEGLSWE GVAGINLFNY FSIYPFNKTK YFGMLAATEM LDPPHYNKLI KGIMRIFSSH       240
     NIDYSYYTEH ELVDAHHASG WLNHVVIPEL ARKPYKTQDF WLGFYMRLDS TKKYYDQLLN       300
     SLIMKKAA                                                                308
//

If you have problems or comments...

PBIL Back to PBIL home page