(data stored in ACNUC7421 zone)

EMBL: CP000675.PE790

CP000675.PE790       Location/Qualifiers
FT   CDS             complement(867467..869125)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPC_2598"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_2598"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ56513"
FT                   /protein_id="ABQ56513.2"
FT                   /translation="MRDKIITGNKVIFSQSVAKDQTKNLSSFLSNRFYSVNQSHNHSII
FT                   IGSSLSHQENDIEHDTILDTSGMLVTTDTNGLVNGARVAITDGLGGGNGDQEEDDEIYR
FT                   VSHSSCENFLNCNQNMDTTLSLITQPKASDKKQTAPKTLQHTEASMAAFIYQNHPGKGY
FT                   IGQFANIGDGLIIILDKRFKIKHMVSACHIYRGFGTWTPPSLQALATTANKDALLVRQT
FT                   LKLAEGDIIISMTDGVWGELKTSLIAQTNDRRDIGVDKEYFKTLFDELTDSPYPSSFDI
FT                   ARIITSSAMSRSLERRKTLIKLINEIEQQHFHEKSVKTINEVLEYFLKTGHVETAQTLK
FT                   AILFEDGLSDGITYFENIEIPLEMVMHDLKSRTVGDCSTINVTRIPYHLDELIRGFINY
FT                   PEKHQILAPLFKARVKSEADLEEAFHRLSLEMVQAEIECPISEAHFERAFKKETLDKTQ
FT                   AVLTHYFRISTGLDSKKNYQERLNDLSAYLSKESSLEKNDIKLLLSMLDSEIKPKTGVF
FT                   QTLFGENQNKLYKAFHKKIELQFLDGEIENKNELK"
     MRDKIITGNK VIFSQSVAKD QTKNLSSFLS NRFYSVNQSH NHSIIIGSSL SHQENDIEHD        60
     TILDTSGMLV TTDTNGLVNG ARVAITDGLG GGNGDQEEDD EIYRVSHSSC ENFLNCNQNM       120
     DTTLSLITQP KASDKKQTAP KTLQHTEASM AAFIYQNHPG KGYIGQFANI GDGLIIILDK       180
     RFKIKHMVSA CHIYRGFGTW TPPSLQALAT TANKDALLVR QTLKLAEGDI IISMTDGVWG       240
     ELKTSLIAQT NDRRDIGVDK EYFKTLFDEL TDSPYPSSFD IARIITSSAM SRSLERRKTL       300
     IKLINEIEQQ HFHEKSVKTI NEVLEYFLKT GHVETAQTLK AILFEDGLSD GITYFENIEI       360
     PLEMVMHDLK SRTVGDCSTI NVTRIPYHLD ELIRGFINYP EKHQILAPLF KARVKSEADL       420
     EEAFHRLSLE MVQAEIECPI SEAHFERAFK KETLDKTQAV LTHYFRISTG LDSKKNYQER       480
     LNDLSAYLSK ESSLEKNDIK LLLSMLDSEI KPKTGVFQTL FGENQNKLYK AFHKKIELQF       540
     LDGEIENKNE LK                                                           552
//

If you have problems or comments...

PBIL Back to PBIL home page