(data stored in ACNUC7421 zone)

EMBL: CP000675.PE792

CP000675.PE792       Location/Qualifiers
FT   CDS             complement(871763..872614)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPC_2596"
FT                   /product="hypothetical protein"
FT                   /note="similar to ydaO, E. coli"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_2596"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ56511"
FT                   /db_xref="GOA:A5IGL1"
FT                   /db_xref="InterPro:IPR011063"
FT                   /db_xref="InterPro:IPR012089"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR035107"
FT                   /db_xref="UniProtKB/Swiss-Prot:A5IGL1"
FT                   /protein_id="ABQ56511.1"
FT                   /translation="MSSNPSSVEKKLLHYTGKAIADFNMIRHGDRVMVCLSGGKDSFTL
FT                   LTILNQLRIKSGNKFEIFAFTLDQAQPGWNDACLRQWLAEKSIPHEILTRDTYSIVKEK
FT                   IPEGKTYCSLCSRLRRGIIYRYAEENGFNKIALGHHRDDLIRTLMMSILYNGDIRSMPP
FT                   KLLSDNKKHIVIRPLCYVQEKDIITFASEQAFPIIPCNLCGSQENLMRKKVASLIDQLA
FT                   IENPKVPSNMLHALQSLKPSQLMDQNFWNFKNLEDGLETAQSVQCEEVFNAQEFEFEDE
FT                   KI"
     MSSNPSSVEK KLLHYTGKAI ADFNMIRHGD RVMVCLSGGK DSFTLLTILN QLRIKSGNKF        60
     EIFAFTLDQA QPGWNDACLR QWLAEKSIPH EILTRDTYSI VKEKIPEGKT YCSLCSRLRR       120
     GIIYRYAEEN GFNKIALGHH RDDLIRTLMM SILYNGDIRS MPPKLLSDNK KHIVIRPLCY       180
     VQEKDIITFA SEQAFPIIPC NLCGSQENLM RKKVASLIDQ LAIENPKVPS NMLHALQSLK       240
     PSQLMDQNFW NFKNLEDGLE TAQSVQCEEV FNAQEFEFED EKI                         283
//

If you have problems or comments...

PBIL Back to PBIL home page