(data stored in ACNUC7421 zone)

EMBL: CP000675.PE80

CP000675.PE80        Location/Qualifiers
FT   CDS             78222..79031
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPC_0080"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_0080"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ54080"
FT                   /protein_id="ABQ54080.1"
FT                   /translation="MLVSNEKVIAEEWEKYAGYTVRPLPSTCAYYKDLIQSNSNKDSFL
FT                   IYGGTPEIRSLFQESNLKVTLTDQSELIVRAMGYLTMGAAPIAANEELVVTNWLNLEGI
FT                   ANDSCDFLIGDDAINMVEWTQFDLFLSNANRVLKSNGLFICHLLVKPQECFITNTIDDV
FT                   RREYKEGVIRTKYDLASRLNFICYDTNSYAMGWQNTIEQLGINQLDQFKPSFDFVGTFG
FT                   RCNSKFYCPPQDAFERLLTNYFHIEEVFYPHEYEYCQFEPVYVLRKK"
     MLVSNEKVIA EEWEKYAGYT VRPLPSTCAY YKDLIQSNSN KDSFLIYGGT PEIRSLFQES        60
     NLKVTLTDQS ELIVRAMGYL TMGAAPIAAN EELVVTNWLN LEGIANDSCD FLIGDDAINM       120
     VEWTQFDLFL SNANRVLKSN GLFICHLLVK PQECFITNTI DDVRREYKEG VIRTKYDLAS       180
     RLNFICYDTN SYAMGWQNTI EQLGINQLDQ FKPSFDFVGT FGRCNSKFYC PPQDAFERLL       240
     TNYFHIEEVF YPHEYEYCQF EPVYVLRKK                                         269
//

If you have problems or comments...

PBIL Back to PBIL home page