(data stored in ACNUC7421 zone)

EMBL: CP000675.PE801

CP000675.PE801       Location/Qualifiers
FT   CDS             complement(880518..881690)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPC_2587"
FT                   /product="(outer) membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_2587"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ56502"
FT                   /protein_id="ABQ56502.1"
FT                   /translation="MRLIFTGVLCLLTLNAQANVIQYFAGISYNNPADLFKVKNGILLV
FT                   GGTGSYADLQFKGSALNFNTFQYDSGVNHSRTYIVWPYGRVAKRLNDKTVVAVDLTEPF
FT                   NSNLDWGNDAFTRYAATQNYLTDVDLSPKISYAISKKLQIGGGINFNVLLKNEVNWAFP
FT                   TGQSTYANLINRSSSFGVGYNLGINYAVNDTNFLGITYYSRIRQNTSGTSYLGLAANPD
FT                   FQFGFYMPATTVASYVHIFNPKWLINLQVFQSEWNANQKVRLYNTAAPPPFTNFIFDMH
FT                   FDASYAYLAAIRKQVSDKLGIALAGMIDDGPEEDGLRTIVFPSDTQYFLGLIGDYRFTE
FT                   HASMELILGHVYSNPSIQNKAKVNNVPVPFTTGRVTINANVLDLKVKIEG"
     MRLIFTGVLC LLTLNAQANV IQYFAGISYN NPADLFKVKN GILLVGGTGS YADLQFKGSA        60
     LNFNTFQYDS GVNHSRTYIV WPYGRVAKRL NDKTVVAVDL TEPFNSNLDW GNDAFTRYAA       120
     TQNYLTDVDL SPKISYAISK KLQIGGGINF NVLLKNEVNW AFPTGQSTYA NLINRSSSFG       180
     VGYNLGINYA VNDTNFLGIT YYSRIRQNTS GTSYLGLAAN PDFQFGFYMP ATTVASYVHI       240
     FNPKWLINLQ VFQSEWNANQ KVRLYNTAAP PPFTNFIFDM HFDASYAYLA AIRKQVSDKL       300
     GIALAGMIDD GPEEDGLRTI VFPSDTQYFL GLIGDYRFTE HASMELILGH VYSNPSIQNK       360
     AKVNNVPVPF TTGRVTINAN VLDLKVKIEG                                        390
//

If you have problems or comments...

PBIL Back to PBIL home page