(data stored in ACNUC7421 zone)

EMBL: CP000675.PE802

CP000675.PE802       Location/Qualifiers
FT   CDS             complement(881747..882721)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPC_2586"
FT                   /product="IcmL-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_2586"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ56501"
FT                   /protein_id="ABQ56501.1"
FT                   /translation="MKKTVLWGALFTLITTQANSEATQQAISTQNSASTGTNVVSESTN
FT                   QVPATNQNTQQNQLNQPVQSNGQQPTQTIQNNQQNQPSQTGEQQSNQNTQNNQQNQPAQ
FT                   QQTTQQPAQQQVPSQQTAPVINCDYKISAETKAIEQSLVLTWSEKAIIQSFDFDPATVD
FT                   AQLQKLQACFTDQGWLSFNSALQKSGNLDAIKSQKLHVSSQIDGQPQVTEAIENQWKII
FT                   IPLQVVYQNDKEKVTQLLNVNVTVGRKITGDLGINQMIAVPRTATNTSQTNSPSNTNPA
FT                   DSNTSTSQTPGDTTNNATQTNTQTQTGTPTNSPPSGSTTNTQN"
     MKKTVLWGAL FTLITTQANS EATQQAISTQ NSASTGTNVV SESTNQVPAT NQNTQQNQLN        60
     QPVQSNGQQP TQTIQNNQQN QPSQTGEQQS NQNTQNNQQN QPAQQQTTQQ PAQQQVPSQQ       120
     TAPVINCDYK ISAETKAIEQ SLVLTWSEKA IIQSFDFDPA TVDAQLQKLQ ACFTDQGWLS       180
     FNSALQKSGN LDAIKSQKLH VSSQIDGQPQ VTEAIENQWK IIIPLQVVYQ NDKEKVTQLL       240
     NVNVTVGRKI TGDLGINQMI AVPRTATNTS QTNSPSNTNP ADSNTSTSQT PGDTTNNATQ       300
     TNTQTQTGTP TNSPPSGSTT NTQN                                              324
//

If you have problems or comments...

PBIL Back to PBIL home page