(data stored in ACNUC7421 zone)

EMBL: CP000675.PE809

CP000675.PE809       Location/Qualifiers
FT   CDS             complement(888867..889964)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPC_2579"
FT                   /product="sensor histidine kinase"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_2579"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ56494"
FT                   /protein_id="ABQ56494.1"
FT                   /translation="MYWRFANSMSITNRLLLIFIGSTVLILSIITGLIYPPMKELLHHS
FT                   HLNNEHYNYLLTRICIKNFFVGLWFSTLIIILASYLLAKKSMRPIKIFTKELASINASS
FT                   LEKRLPYTGNPKELEELALTCNDMLFRIESAFSHIKQFSASIAHELRNPIHYLRTATEI
FT                   TLTKPQTIETYQHVLQTHLEEYQSLTQLIDNLLFLTRCEHGQLQLNVRTLSANHLISSI
FT                   IEYYYSIAQEKGIEIQMFGEAQIEVDEHLFKRVISNLIDNSLTYTNKGGRILIIIEKRT
FT                   DNSIQIRIKDNGIGISKEHLPLLYHGFYRVDYSTNKENAGLGLGLAIAKSIMEHHKGQL
FT                   AIDSKMGLGTTVILTLPGKSFLKIE"
     MYWRFANSMS ITNRLLLIFI GSTVLILSII TGLIYPPMKE LLHHSHLNNE HYNYLLTRIC        60
     IKNFFVGLWF STLIIILASY LLAKKSMRPI KIFTKELASI NASSLEKRLP YTGNPKELEE       120
     LALTCNDMLF RIESAFSHIK QFSASIAHEL RNPIHYLRTA TEITLTKPQT IETYQHVLQT       180
     HLEEYQSLTQ LIDNLLFLTR CEHGQLQLNV RTLSANHLIS SIIEYYYSIA QEKGIEIQMF       240
     GEAQIEVDEH LFKRVISNLI DNSLTYTNKG GRILIIIEKR TDNSIQIRIK DNGIGISKEH       300
     LPLLYHGFYR VDYSTNKENA GLGLGLAIAK SIMEHHKGQL AIDSKMGLGT TVILTLPGKS       360
     FLKIE                                                                   365
//

If you have problems or comments...

PBIL Back to PBIL home page