(data stored in ACNUC7421 zone)

EMBL: CP000675.PE811

CP000675.PE811       Location/Qualifiers
FT   CDS             890765..891760
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPC_2577"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_2577"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ56492"
FT                   /protein_id="ABQ56492.1"
FT                   /translation="MSKNESGTAKPIIKSTLMFFNSKLTDLNDKRLQLNRGKGLAKYLA
FT                   KSQKNTRDLAPLDAALGVMSFSLYMLRFSANVGLLAHLILVESQEKTNHKIRRDIYYSL
FT                   LNDSLWCVVNLTQFFWLSYRNSISAGLQGMQLETLAQLIDILVMIIRYQQDKKEYDLKY
FT                   NQAMGMERSRLAIEWQNKELNGLRSLLTSLSVVIAFGLFSFSAVAVPLSPVISSIILIS
FT                   SLLRVLIDIEKDRQLIHQLKLNETSREQIKNEQLAMTNARMKDLNKIILNSVFLPIGFF
FT                   LLITTPIPLTIIACVSMLLVHWLITNLINMRYSPNISVSPTIQTAELSLC"
     MSKNESGTAK PIIKSTLMFF NSKLTDLNDK RLQLNRGKGL AKYLAKSQKN TRDLAPLDAA        60
     LGVMSFSLYM LRFSANVGLL AHLILVESQE KTNHKIRRDI YYSLLNDSLW CVVNLTQFFW       120
     LSYRNSISAG LQGMQLETLA QLIDILVMII RYQQDKKEYD LKYNQAMGME RSRLAIEWQN       180
     KELNGLRSLL TSLSVVIAFG LFSFSAVAVP LSPVISSIIL ISSLLRVLID IEKDRQLIHQ       240
     LKLNETSREQ IKNEQLAMTN ARMKDLNKII LNSVFLPIGF FLLITTPIPL TIIACVSMLL       300
     VHWLITNLIN MRYSPNISVS PTIQTAELSL C                                      331
//

If you have problems or comments...

PBIL Back to PBIL home page