(data stored in ACNUC7421 zone)

EMBL: CP000675.PE818

CP000675.PE818       Location/Qualifiers
FT   CDS             901468..901872
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPC_2570"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_2570"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ56485"
FT                   /protein_id="ABQ56485.1"
FT                   /translation="MKLKSLLFVVCFSLFSNVFAANLHLHPKADNADKKSIQKSVTYPG
FT                   YCQIEIINQSFTDVRVFGTFDDGTTIDFNIYRYESPHYISLFYNFYCHSGMYITITSPY
FT                   YTIYSGWTNVNSTIRVVPYLKEAKAELSTR"
     MKLKSLLFVV CFSLFSNVFA ANLHLHPKAD NADKKSIQKS VTYPGYCQIE IINQSFTDVR        60
     VFGTFDDGTT IDFNIYRYES PHYISLFYNF YCHSGMYITI TSPYYTIYSG WTNVNSTIRV       120
     VPYLKEAKAE LSTR                                                         134
//

If you have problems or comments...

PBIL Back to PBIL home page