(data stored in ACNUC7421 zone)

EMBL: CP000675.PE819

CP000675.PE819       Location/Qualifiers
FT   CDS             901938..902375
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPC_2569"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_2569"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ56484"
FT                   /protein_id="ABQ56484.1"
FT                   /translation="MKYLIPCVVLFPLLSSCTVIQEDFYQPEYLGPAPRVEVTPSYPQG
FT                   HYHRHYNQRYHSNNRYYSAPRGQVHYEHAKTQGHAAVVTPPPSQARVEVQKNVHGHNAN
FT                   NGQVHGHAHDNGNVHSHPDSSNVHGHDTSNPEEQKKIHGHS"
     MKYLIPCVVL FPLLSSCTVI QEDFYQPEYL GPAPRVEVTP SYPQGHYHRH YNQRYHSNNR        60
     YYSAPRGQVH YEHAKTQGHA AVVTPPPSQA RVEVQKNVHG HNANNGQVHG HAHDNGNVHS       120
     HPDSSNVHGH DTSNPEEQKK IHGHS                                             145
//

If you have problems or comments...

PBIL Back to PBIL home page