(data stored in ACNUC7421 zone)

EMBL: CP000675.PE82

CP000675.PE82        Location/Qualifiers
FT   CDS             80373..80963
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPC_0082"
FT                   /product="YdeN-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_0082"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ54082"
FT                   /protein_id="ABQ54082.1"
FT                   /translation="MSQSNVIIVHGAYGHPFENWFNWMKTELESLGIECFVPQLPTPDG
FT                   QELKNWLHVFNSTVSPMITHDTILIGHSLGSAFLLRWLEQANQSVFSTILAGPFIGAVG
FT                   IQKFDKINESFFENGFDWHSIINKSKQFFCYHGSNDPYISRSNFNFIANNLQARKIIIS
FT                   QGGHLNEAAGFSSFPQLLIQLKLLLGINYGKFI"
     MSQSNVIIVH GAYGHPFENW FNWMKTELES LGIECFVPQL PTPDGQELKN WLHVFNSTVS        60
     PMITHDTILI GHSLGSAFLL RWLEQANQSV FSTILAGPFI GAVGIQKFDK INESFFENGF       120
     DWHSIINKSK QFFCYHGSND PYISRSNFNF IANNLQARKI IISQGGHLNE AAGFSSFPQL       180
     LIQLKLLLGI NYGKFI                                                       196
//

If you have problems or comments...

PBIL Back to PBIL home page