(data stored in ACNUC7421 zone)

EMBL: CP000675.PE89

CP000675.PE89        Location/Qualifiers
FT   CDS             complement(85642..85812)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPC_0089"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_0089"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ54089"
FT                   /protein_id="ABQ54089.1"
FT                   /translation="MKWLSIRHQLMFRQGFTSASVMLDSKLAKRCLLSKGFWKEFCPIP
FT                   IGGIGQNAEKC"
     MKWLSIRHQL MFRQGFTSAS VMLDSKLAKR CLLSKGFWKE FCPIPIGGIG QNAEKC            56
//

If you have problems or comments...

PBIL Back to PBIL home page