(data stored in ACNUC7421 zone)

EMBL: CP000675.PE9

CP000675.PE9         Location/Qualifiers
FT   CDS             complement(11607..12866)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPC_0009"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_0009"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ54009"
FT                   /protein_id="ABQ54009.1"
FT                   /translation="MTFTCDELKGLEHPYKVLGNGDALAENREELNKLTNDEKLVLASR
FT                   LVLECPVNELKDFAHAIEAARMPQDDSDTFHSFLFQAYQVKKRIISLLDPRNKNPHSMI
FT                   LEKEFDGELFNNFNKLAIDVLTNNEVAIALRLAETTPAQDRSRVSQNINNIFPQSLFAA
FT                   KVGHAFAVRRDIERLLLGDRPDQFFSSREFKIDSCIEFASLFNVINDKESSIAGKLALR
FT                   TPAENRSDVVMKIKGFCAEDSELAIKVQSAFALRRDIERNLLGDNPEQFFNSRDFSVDL
FT                   CLEFAILFPELLKGHEQAIGEKLAKLDAKVRSDISRKLEMINGAAHEQSSPFRIIASAM
FT                   VPKEEPCLTKPTPVVLPSTEEIIPKQESPTSLRNRNVLFKEQTEEHKKKNSQMEPIASD
FT                   SEEEEEKQNCWTSFCGLFGK"
     MTFTCDELKG LEHPYKVLGN GDALAENREE LNKLTNDEKL VLASRLVLEC PVNELKDFAH        60
     AIEAARMPQD DSDTFHSFLF QAYQVKKRII SLLDPRNKNP HSMILEKEFD GELFNNFNKL       120
     AIDVLTNNEV AIALRLAETT PAQDRSRVSQ NINNIFPQSL FAAKVGHAFA VRRDIERLLL       180
     GDRPDQFFSS REFKIDSCIE FASLFNVIND KESSIAGKLA LRTPAENRSD VVMKIKGFCA       240
     EDSELAIKVQ SAFALRRDIE RNLLGDNPEQ FFNSRDFSVD LCLEFAILFP ELLKGHEQAI       300
     GEKLAKLDAK VRSDISRKLE MINGAAHEQS SPFRIIASAM VPKEEPCLTK PTPVVLPSTE       360
     EIIPKQESPT SLRNRNVLFK EQTEEHKKKN SQMEPIASDS EEEEEKQNCW TSFCGLFGK        419
//

If you have problems or comments...

PBIL Back to PBIL home page