(data stored in ACNUC7421 zone)

EMBL: CP000675.PE90

CP000675.PE90        Location/Qualifiers
FT   CDS             complement(86285..87697)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPC_0090"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_0090"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ54090"
FT                   /protein_id="ABQ54090.1"
FT                   /translation="MKSKKILILGLSITLTAITSASYAKKIFPSDIIGRDLNYPGMGWL
FT                   GHVGIATRPMMDSSGMSTPANQVIEILNEPVIGQINTIDNFKRRSPYWGSKYGVIGNPE
FT                   QGYRVLVEANHQRWWVREYTSNTDYRIAQGNPRTGEIFVTGRWRCDTYAWWAFYSQGVD
FT                   TMPGRIWLPRNLFNFFPYYNDERLVAESSEPSAEILTNKSLDDVSAEDLNEMSLEEFQT
FT                   VIDAPLKAPTNYVAPMSAYMRFAYSDSLNDIKRGAMIDKITSKVSDVDLVPKLLRLYDE
FT                   TDREEVKNKIVSGLMFHVQGELREHPNSRDKELLRSFFHRLIGEKLNQRCADWATMGFI
FT                   DTHTADETLQNLDKIDAQLATATHPASITLKYKLVHKSKKLQSIYIKSIVDELREANNS
FT                   DLDSYFFGPLAIGYQGTGKNLLEPESKQIVINYLDEVRYKYTSKGIKANPSDFHRGTTA
FT                   PYYFELLKHMDN"
     MKSKKILILG LSITLTAITS ASYAKKIFPS DIIGRDLNYP GMGWLGHVGI ATRPMMDSSG        60
     MSTPANQVIE ILNEPVIGQI NTIDNFKRRS PYWGSKYGVI GNPEQGYRVL VEANHQRWWV       120
     REYTSNTDYR IAQGNPRTGE IFVTGRWRCD TYAWWAFYSQ GVDTMPGRIW LPRNLFNFFP       180
     YYNDERLVAE SSEPSAEILT NKSLDDVSAE DLNEMSLEEF QTVIDAPLKA PTNYVAPMSA       240
     YMRFAYSDSL NDIKRGAMID KITSKVSDVD LVPKLLRLYD ETDREEVKNK IVSGLMFHVQ       300
     GELREHPNSR DKELLRSFFH RLIGEKLNQR CADWATMGFI DTHTADETLQ NLDKIDAQLA       360
     TATHPASITL KYKLVHKSKK LQSIYIKSIV DELREANNSD LDSYFFGPLA IGYQGTGKNL       420
     LEPESKQIVI NYLDEVRYKY TSKGIKANPS DFHRGTTAPY YFELLKHMDN                  470
//

If you have problems or comments...

PBIL Back to PBIL home page