(data stored in ACNUC7421 zone)

EMBL: CP000675.PE97

CP000675.PE97        Location/Qualifiers
FT   CDS             95975..96556
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPC_0098"
FT                   /product="hypothetical protein conserved within
FT                   Legionellae"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_0098"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ54097"
FT                   /protein_id="ABQ54097.1"
FT                   /translation="MSLDNDSLHLPKYDDFVQSISVLALTMSGSELHGIMCGYLCAGAD
FT                   SQGEAYIRALLNNKKDEQSRNALLSMFSVFSISQQQMNNFDFEFEMLLPDDDESLVTRA
FT                   QAFSEWCEGFTQGLTIAGVGMEQFYEEESQDALQHLIEFAELDCESLEVGEEDERALME
FT                   VSEYTRMAVLRLHSDLVLHERELGDSGTTH"
     MSLDNDSLHL PKYDDFVQSI SVLALTMSGS ELHGIMCGYL CAGADSQGEA YIRALLNNKK        60
     DEQSRNALLS MFSVFSISQQ QMNNFDFEFE MLLPDDDESL VTRAQAFSEW CEGFTQGLTI       120
     AGVGMEQFYE EESQDALQHL IEFAELDCES LEVGEEDERA LMEVSEYTRM AVLRLHSDLV       180
     LHERELGDSG TTH                                                          193
//

If you have problems or comments...

PBIL Back to PBIL home page