(data stored in ACNUC7421 zone)

EMBL: CP000675.PGK

CP000675.PGK         Location/Qualifiers
FT   CDS             complement(173210..174400)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pgk"
FT                   /locus_tag="LPC_0158"
FT                   /product="phosphoglycerate kinase"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_0158"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ54157"
FT                   /db_xref="GOA:A5I9V7"
FT                   /db_xref="InterPro:IPR001576"
FT                   /db_xref="InterPro:IPR015824"
FT                   /db_xref="InterPro:IPR015911"
FT                   /db_xref="InterPro:IPR036043"
FT                   /db_xref="UniProtKB/Swiss-Prot:A5I9V7"
FT                   /protein_id="ABQ54157.1"
FT                   /translation="MNLIKMSDIDLSGKRVLIREDLNVPIKDGMITSDQRLQAALPTIK
FT                   SALDSGAAVIVLSHLGRPEEGKYEKKFSLEPVADYLRENLEYPVRFVKDYLTGVDVNPG
FT                   ELVVCENVRFNPGEKGNDEALAKKLASLCDVFVMDAFGTAHRAQASTYGVAQYAPVAVA
FT                   GPLLIRELEALNQVLKAPKKPIVAIVGGAKVSSKLSLLKQLVGMVDVLIPGGGIANTFL
FT                   KAQGFEIGISLYEPDLLDEARHILILAKEKGCQIPLPTDVVVGKTFSETCPAFNKSLSN
FT                   VAADDMILDIGPETIRDYVDLIHEANTIIWNGPVGVFEFPQFAYGTRAIAIAIAESDAF
FT                   SIAGGGDTLAAVDLYDLNQQISYISTGGGAFLECLEGKTLPAVAILQERAKHVKTN"
     MNLIKMSDID LSGKRVLIRE DLNVPIKDGM ITSDQRLQAA LPTIKSALDS GAAVIVLSHL        60
     GRPEEGKYEK KFSLEPVADY LRENLEYPVR FVKDYLTGVD VNPGELVVCE NVRFNPGEKG       120
     NDEALAKKLA SLCDVFVMDA FGTAHRAQAS TYGVAQYAPV AVAGPLLIRE LEALNQVLKA       180
     PKKPIVAIVG GAKVSSKLSL LKQLVGMVDV LIPGGGIANT FLKAQGFEIG ISLYEPDLLD       240
     EARHILILAK EKGCQIPLPT DVVVGKTFSE TCPAFNKSLS NVAADDMILD IGPETIRDYV       300
     DLIHEANTII WNGPVGVFEF PQFAYGTRAI AIAIAESDAF SIAGGGDTLA AVDLYDLNQQ       360
     ISYISTGGGA FLECLEGKTL PAVAILQERA KHVKTN                                 396
//

If you have problems or comments...

PBIL Back to PBIL home page