(data stored in ACNUC7421 zone)

EMBL: CP000675.PLED

CP000675.PLED        Location/Qualifiers
FT   CDS             complement(319469..321613)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pleD"
FT                   /locus_tag="LPC_0305"
FT                   /product="sensor histidine kinase"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_0305"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ54300"
FT                   /protein_id="ABQ54300.1"
FT                   /translation="MNNTWHQTATGNRSISNYLRLSRTLLNVIFIIALSLLLIINIISY
FT                   NQVKNLLLAINWVSQSYEIIQTIDTCLYEVVSIESRQRFYLIRDSNNQHMVDVDEMKSA
FT                   LKLNLDKLEKLTRNNLEQNKRTNRFTDLIERRLNLLNQIVQLKAIGKFNTHENYDLLNQ
FT                   SQDMSNQVKSLGQEIKSVELVLLSERKASAVRRADRSSFTLISGGITSILFLLIAFILA
FT                   NSELSSREKTELQNQNTQTQLKKIIESTSDMIAAFDKEHRFITFNEAYQREFKRLFDKY
FT                   ISINLSLEKALVDIPENKKELAEIWKNSLQNNEENKTIELNTEHEKIVYEMSSKLIQNG
FT                   DNEINGVVHSVRNITKRVQEHTELQESYQKLANGMKELQEKNEQITLLVEMSDIMLACS
FT                   SQQELSDVLSKYSQRLLRFSSGYLFIMHPSKNYLEKTTSWGDPQPHELTFTPEQCWAIR
FT                   RGRVHHVDSSHIELLCGHVSFSLEQQDLSLLCVPLMAQNDIYGLLYLEVNLKQLPLFDE
FT                   NQRLLITAFAELTALALANVRLGESLRYQSIRDPLTGLYNRRYLEDFLFKQLHQAERTK
FT                   ASFAILMLDLDHFKKINDTFGHEAGDFVLKEIGQILNNDIRLGDVATRYGGEEFVLLLF
FT                   DVDANAAKTRADNLRSAISKLQVKYGAQYVGQVTASIGISIYPDDAKSPDELIEAADKA
FT                   LYQAKNKGRNMVLLFSEISS"
     MNNTWHQTAT GNRSISNYLR LSRTLLNVIF IIALSLLLII NIISYNQVKN LLLAINWVSQ        60
     SYEIIQTIDT CLYEVVSIES RQRFYLIRDS NNQHMVDVDE MKSALKLNLD KLEKLTRNNL       120
     EQNKRTNRFT DLIERRLNLL NQIVQLKAIG KFNTHENYDL LNQSQDMSNQ VKSLGQEIKS       180
     VELVLLSERK ASAVRRADRS SFTLISGGIT SILFLLIAFI LANSELSSRE KTELQNQNTQ       240
     TQLKKIIEST SDMIAAFDKE HRFITFNEAY QREFKRLFDK YISINLSLEK ALVDIPENKK       300
     ELAEIWKNSL QNNEENKTIE LNTEHEKIVY EMSSKLIQNG DNEINGVVHS VRNITKRVQE       360
     HTELQESYQK LANGMKELQE KNEQITLLVE MSDIMLACSS QQELSDVLSK YSQRLLRFSS       420
     GYLFIMHPSK NYLEKTTSWG DPQPHELTFT PEQCWAIRRG RVHHVDSSHI ELLCGHVSFS       480
     LEQQDLSLLC VPLMAQNDIY GLLYLEVNLK QLPLFDENQR LLITAFAELT ALALANVRLG       540
     ESLRYQSIRD PLTGLYNRRY LEDFLFKQLH QAERTKASFA ILMLDLDHFK KINDTFGHEA       600
     GDFVLKEIGQ ILNNDIRLGD VATRYGGEEF VLLLFDVDAN AAKTRADNLR SAISKLQVKY       660
     GAQYVGQVTA SIGISIYPDD AKSPDELIEA ADKALYQAKN KGRNMVLLFS EISS             714
//

If you have problems or comments...

PBIL Back to PBIL home page