(data stored in ACNUC7421 zone)

EMBL: CP000675.PPK

CP000675.PPK         Location/Qualifiers
FT   CDS             complement(397588..399660)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ppk"
FT                   /locus_tag="LPC_0368"
FT                   /product="polyphosphate kinase"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_0368"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ54363"
FT                   /protein_id="ABQ54363.1"
FT                   /translation="MDTTLDNPDYYINREFSAVAFNQRVLMLANDERVPLLERMRFLSI
FT                   CSSNLDEFFEIRVAGLKEKIAMSSGKLTIDGLRADEAFSQISHKAHALIDQLYNIFNKQ
FT                   LLPALRKENIHFLETDQWTDDIHLWAKHYFKHEILPVISPIALDLAHPLPRLINKSLNF
FT                   IISLSGKDAFDRNINYAVVHAPRSIPRMIHLPSELCGDAHYFVYLSSIIKTHINSLFPG
FT                   MEISGCYSFRLTRNSDLFLREEEIDDLAKAVQREIFSRHYGHVVRLEIENKCPEKIVDF
FT                   LLQKYHLRHEDTYYCDGPVNLQRYMSAINSIDRPDLNYPAFTPQYPKFSKSQRNLFNIL
FT                   DEQDILLHHPYQAFDLVIDFVRQAASDPNVLAINQTLYRTHSESVMVDALVNAAHSGKE
FT                   VTAVIELRARFDEESNLKLANKLHAAGILVLYGVVGYKTHAKMTLVVRRTHGKLKRYVH
FT                   LSTGNYHEQTAKRYTDLGLLTSEPTITSDAQLIFQQLTGLGKVVKLKALSHSPFTLQKT
FT                   LLQFIEQCSTAATGGIDTEIILKVNGLTDKVMIQALYKASQAGVKINLLVRGVCCLKPG
FT                   LPGVSENIRVLSFIGRFLEHHRVFYFRINEEEHYFCSSADLMERNLYNRIEIMFPIYDE
FT                   GCKKRIKNEIIKNYLKDNNNVWEMQSDGTYKHLMQNGGCAQEKLIALYEEEDKSI"
     MDTTLDNPDY YINREFSAVA FNQRVLMLAN DERVPLLERM RFLSICSSNL DEFFEIRVAG        60
     LKEKIAMSSG KLTIDGLRAD EAFSQISHKA HALIDQLYNI FNKQLLPALR KENIHFLETD       120
     QWTDDIHLWA KHYFKHEILP VISPIALDLA HPLPRLINKS LNFIISLSGK DAFDRNINYA       180
     VVHAPRSIPR MIHLPSELCG DAHYFVYLSS IIKTHINSLF PGMEISGCYS FRLTRNSDLF       240
     LREEEIDDLA KAVQREIFSR HYGHVVRLEI ENKCPEKIVD FLLQKYHLRH EDTYYCDGPV       300
     NLQRYMSAIN SIDRPDLNYP AFTPQYPKFS KSQRNLFNIL DEQDILLHHP YQAFDLVIDF       360
     VRQAASDPNV LAINQTLYRT HSESVMVDAL VNAAHSGKEV TAVIELRARF DEESNLKLAN       420
     KLHAAGILVL YGVVGYKTHA KMTLVVRRTH GKLKRYVHLS TGNYHEQTAK RYTDLGLLTS       480
     EPTITSDAQL IFQQLTGLGK VVKLKALSHS PFTLQKTLLQ FIEQCSTAAT GGIDTEIILK       540
     VNGLTDKVMI QALYKASQAG VKINLLVRGV CCLKPGLPGV SENIRVLSFI GRFLEHHRVF       600
     YFRINEEEHY FCSSADLMER NLYNRIEIMF PIYDEGCKKR IKNEIIKNYL KDNNNVWEMQ       660
     SDGTYKHLMQ NGGCAQEKLI ALYEEEDKSI                                        690
//

If you have problems or comments...

PBIL Back to PBIL home page