(data stored in ACNUC7421 zone)

EMBL: CP000675.PRMA

CP000675.PRMA        Location/Qualifiers
FT   CDS             complement(555335..556204)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="prmA"
FT                   /locus_tag="LPC_2882"
FT                   /product="ribosomal protein L11 methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_2882"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ56783"
FT                   /db_xref="GOA:A5IHD3"
FT                   /db_xref="InterPro:IPR004498"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/Swiss-Prot:A5IHD3"
FT                   /protein_id="ABQ56783.1"
FT                   /translation="MWFQLKIEHCPNDKIEEITEELEEYGALSITLTDKNDNPVLEPEP
FT                   GTTPLWPEVIIHALFAQAEEAQYVREQLVAKTPSLHCSLEPLADKNWERAWMDDFRPQR
FT                   FGNRLWVCPTWLPPPEPDAVNLMLDPGLAFGTGTHATTSLCLTWLEQADLKNKSVIDYG
FT                   CGSGILSLAAIKLGAKHVYAVDIDNQALQATQNNAHANHITESQLSISSPEALQNPVHL
FT                   IIANILLAPLISLKERFHQLLPSGAHLVTSGILEEQAPLLIDAYDSAFTHIATEYCEGW
FT                   SLLVFTSK"
     MWFQLKIEHC PNDKIEEITE ELEEYGALSI TLTDKNDNPV LEPEPGTTPL WPEVIIHALF        60
     AQAEEAQYVR EQLVAKTPSL HCSLEPLADK NWERAWMDDF RPQRFGNRLW VCPTWLPPPE       120
     PDAVNLMLDP GLAFGTGTHA TTSLCLTWLE QADLKNKSVI DYGCGSGILS LAAIKLGAKH       180
     VYAVDIDNQA LQATQNNAHA NHITESQLSI SSPEALQNPV HLIIANILLA PLISLKERFH       240
     QLLPSGAHLV TSGILEEQAP LLIDAYDSAF THIATEYCEG WSLLVFTSK                   289
//

If you have problems or comments...

PBIL Back to PBIL home page