(data stored in ACNUC7421 zone)

EMBL: CP000675.PVCB

CP000675.PVCB        Location/Qualifiers
FT   CDS             265702..266538
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pvcB"
FT                   /locus_tag="LPC_0257"
FT                   /product="pyoverdine biosynthesis protein PvcB"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_0257"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ54253"
FT                   /protein_id="ABQ54253.1"
FT                   /translation="MNYKVTSLKPFGVLLEPVSEKTKVTDVDIENLRHLFAKNQLVVLR
FT                   GFCAFQNAEDFSNYCELWGEVSLWPFGKVLELIEQEDPEDHIFDHSYMPLHWDGMYRPQ
FT                   VPEYQIFHCVKAPLPGQGGRTTFSNTILALQFASSEIKELWNKVCGTYQRKMEFYNSKT
FT                   VSPIIMKHPQKDFSVIRYNEPPSADKGHFVNPPDIEFTGIDQEELDFFHRSLNKALYSA
FT                   DNFYAHEWQNGDIVIADNFSLLHGREGFVSRSPRHIQRVHVLSNPPFDNPGLESYQ"
     MNYKVTSLKP FGVLLEPVSE KTKVTDVDIE NLRHLFAKNQ LVVLRGFCAF QNAEDFSNYC        60
     ELWGEVSLWP FGKVLELIEQ EDPEDHIFDH SYMPLHWDGM YRPQVPEYQI FHCVKAPLPG       120
     QGGRTTFSNT ILALQFASSE IKELWNKVCG TYQRKMEFYN SKTVSPIIMK HPQKDFSVIR       180
     YNEPPSADKG HFVNPPDIEF TGIDQEELDF FHRSLNKALY SADNFYAHEW QNGDIVIADN       240
     FSLLHGREGF VSRSPRHIQR VHVLSNPPFD NPGLESYQ                               278
//

If you have problems or comments...

PBIL Back to PBIL home page