(data stored in ACNUC7421 zone)

EMBL: CP000675.PYKA

CP000675.PYKA        Location/Qualifiers
FT   CDS             complement(171802..173226)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pykA"
FT                   /locus_tag="LPC_0157"
FT                   /product="pyruvate kinase II"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_0157"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ54156"
FT                   /protein_id="ABQ54156.1"
FT                   /translation="MLRRTKIVATLGPASKEPEILRSMLAAGVNVVRINFSHADSSALQ
FT                   LIALVRKIADELNHPVAVMADLQGPKIRVGRFQNKSITLIDGQNFTLDCMAPDTLGDIN
FT                   GVSVAYPNLANELSISDHLLINDGLIELEVIEISGSKIHCKVVEGGVLTDLKGLNRKGG
FT                   GLAARTLTEKDRNDLRTAIEAEVDYISLSFVKDAEDIRQARALMKDYGAQITPIIAKIE
FT                   RMEALDHLTDIIREADAIMVARGDLGVEVGAAEVPAIQKHIIEQTRLLDKVVITATQMM
FT                   ESMISNPQPTRAEVSDVANAILDGTDAVMLSAETASGLFPVKVITMVNKICLSAEKHAS
FT                   FFYHSDLETCHYQRADQAIAMATMHTANHFPIQAIITLTESGDTALWVSRHHSTVPIFA
FT                   ISANKRTIGRLSLVNNVFPIYIDFHQFNPEGLNQQILHELIKSGHLEKRGYVLLTRGTQ
FT                   IGMPGGTNCMEIIPVV"
     MLRRTKIVAT LGPASKEPEI LRSMLAAGVN VVRINFSHAD SSALQLIALV RKIADELNHP        60
     VAVMADLQGP KIRVGRFQNK SITLIDGQNF TLDCMAPDTL GDINGVSVAY PNLANELSIS       120
     DHLLINDGLI ELEVIEISGS KIHCKVVEGG VLTDLKGLNR KGGGLAARTL TEKDRNDLRT       180
     AIEAEVDYIS LSFVKDAEDI RQARALMKDY GAQITPIIAK IERMEALDHL TDIIREADAI       240
     MVARGDLGVE VGAAEVPAIQ KHIIEQTRLL DKVVITATQM MESMISNPQP TRAEVSDVAN       300
     AILDGTDAVM LSAETASGLF PVKVITMVNK ICLSAEKHAS FFYHSDLETC HYQRADQAIA       360
     MATMHTANHF PIQAIITLTE SGDTALWVSR HHSTVPIFAI SANKRTIGRL SLVNNVFPIY       420
     IDFHQFNPEG LNQQILHELI KSGHLEKRGY VLLTRGTQIG MPGGTNCMEI IPVV             474
//

If you have problems or comments...

PBIL Back to PBIL home page