(data stored in ACNUC7421 zone)

EMBL: CP000675.RECF

CP000675.RECF        Location/Qualifiers
FT   CDS             3127..4188
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="recF"
FT                   /locus_tag="LPC_0003"
FT                   /product="DNA recombination and repair protein ATPase RecF"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_0003"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ54003"
FT                   /protein_id="ABQ54003.1"
FT                   /translation="MILSEVRIHNFRNIASTSLILNPNFNCITGPNGSGKTSLLEALYM
FT                   LSCAHSFRSREVAPIISYGQNQLNVFAHTYDESTISVQKSITDGTQIKLNNQFCCTTSQ
FT                   LAYALPCQVIYSDIFQIIDAGPSVRRSLLDWGLFHVKHDYLKIWKDYKRILSQRNALLK
FT                   SRATYEHFIPWDQQLSQLANQLDKARNDYFLQWQPKFYQVLSDLTNISCTIEYYKGWDR
FT                   KNAGQNMEELLQKSFDSDKNKLYTQYGPHQADLIINIEQYRVKHTLSRGQQKIILIALK
FT                   LAQGQLLDKDCLYLIDDLAAELDDYHQRNLIKYLTQQKGQFVITNLINNNNYDILPIDS
FT                   GLFEVNCGAIKVL"
     MILSEVRIHN FRNIASTSLI LNPNFNCITG PNGSGKTSLL EALYMLSCAH SFRSREVAPI        60
     ISYGQNQLNV FAHTYDESTI SVQKSITDGT QIKLNNQFCC TTSQLAYALP CQVIYSDIFQ       120
     IIDAGPSVRR SLLDWGLFHV KHDYLKIWKD YKRILSQRNA LLKSRATYEH FIPWDQQLSQ       180
     LANQLDKARN DYFLQWQPKF YQVLSDLTNI SCTIEYYKGW DRKNAGQNME ELLQKSFDSD       240
     KNKLYTQYGP HQADLIINIE QYRVKHTLSR GQQKIILIAL KLAQGQLLDK DCLYLIDDLA       300
     AELDDYHQRN LIKYLTQQKG QFVITNLINN NNYDILPIDS GLFEVNCGAI KVL              353
//

If you have problems or comments...

PBIL Back to PBIL home page