(data stored in ACNUC7421 zone)

EMBL: CP000675.RECN

CP000675.RECN        Location/Qualifiers
FT   CDS             338543..339310
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="recN"
FT                   /locus_tag="LPC_0316"
FT                   /product="DNA repair protein"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_0316"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ54311"
FT                   /protein_id="ABQ54311.1"
FT                   /translation="MWYQNIMRNLLEKLPEASRKDGEIFLSKLFLAVKKVDNKPEMEFF
FT                   LGLIEKSFLKFENEKSGSVTLAKFSRYILGLTLLYLKSSNDLAIWNSDFIPSLTEIKKC
FT                   LEAEKAGKPFYKFINQLEVETFASLNHQLAIDFNHFSAILKRNSDLKTIQSFTEACKGL
FT                   GNDVSQGFSQVMQDAEAHMINLQFAVDFDSGFGHESTDENQGNTKLQKPSHVNYMSMSA
FT                   NNLHRLGIFKLLAMSDGLSDQSNLFINQNNELR"
     MWYQNIMRNL LEKLPEASRK DGEIFLSKLF LAVKKVDNKP EMEFFLGLIE KSFLKFENEK        60
     SGSVTLAKFS RYILGLTLLY LKSSNDLAIW NSDFIPSLTE IKKCLEAEKA GKPFYKFINQ       120
     LEVETFASLN HQLAIDFNHF SAILKRNSDL KTIQSFTEAC KGLGNDVSQG FSQVMQDAEA       180
     HMINLQFAVD FDSGFGHEST DENQGNTKLQ KPSHVNYMSM SANNLHRLGI FKLLAMSDGL       240
     SDQSNLFINQ NNELR                                                        255
//

If you have problems or comments...

PBIL Back to PBIL home page