(data stored in ACNUC7421 zone)

EMBL: CP000675.RIMK

CP000675.RIMK        Location/Qualifiers
FT   CDS             505573..506481
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rimK"
FT                   /locus_tag="LPC_2929"
FT                   /product="glutathione synthase, ribosomal protein S6
FT                   modification protein"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_2929"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ56830"
FT                   /db_xref="GOA:A5IHI0"
FT                   /db_xref="InterPro:IPR004666"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR013651"
FT                   /db_xref="InterPro:IPR013815"
FT                   /db_xref="InterPro:IPR023533"
FT                   /db_xref="InterPro:IPR041107"
FT                   /db_xref="UniProtKB/Swiss-Prot:A5IHI0"
FT                   /protein_id="ABQ56830.1"
FT                   /translation="MKIAILATNPHLYSHKRLKAEAEAAGHEVKIINPLYCYMNVAASN
FT                   PKVHYRGGAPLPHFDAVIPRIGASITYYGTAVLRHMETMGMYTLNESIAISRSRDKFRS
FT                   LQLLARKGIPMPLTSFAQSPDDTEDLIHMVGGAPLVIKLLEGTQGKGVILADSHQSAVS
FT                   IINAFKEMHANILVQEFIEESRGTDIRCFVIGEKVVAAVKRQAKDGEFRANVHQGGKAV
FT                   KVKLSPQERAIAVSAAKTMGLRVAGVDLIRSNHGPLVLEINSSPGLEGIEKATNINLAG
FT                   KIIEYIEKKAKPISSNHRFHG"
     MKIAILATNP HLYSHKRLKA EAEAAGHEVK IINPLYCYMN VAASNPKVHY RGGAPLPHFD        60
     AVIPRIGASI TYYGTAVLRH METMGMYTLN ESIAISRSRD KFRSLQLLAR KGIPMPLTSF       120
     AQSPDDTEDL IHMVGGAPLV IKLLEGTQGK GVILADSHQS AVSIINAFKE MHANILVQEF       180
     IEESRGTDIR CFVIGEKVVA AVKRQAKDGE FRANVHQGGK AVKVKLSPQE RAIAVSAAKT       240
     MGLRVAGVDL IRSNHGPLVL EINSSPGLEG IEKATNINLA GKIIEYIEKK AKPISSNHRF       300
     HG                                                                      302
//

If you have problems or comments...

PBIL Back to PBIL home page