(data stored in ACNUC7421 zone)

EMBL: CP000675.RPLB

CP000675.RPLB        Location/Qualifiers
FT   CDS             438734..439561
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplB"
FT                   /locus_tag="LPC_3010"
FT                   /product="50S ribosomal protein L2"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_3010"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ56911"
FT                   /db_xref="GOA:A5IHR1"
FT                   /db_xref="InterPro:IPR002171"
FT                   /db_xref="InterPro:IPR005880"
FT                   /db_xref="InterPro:IPR008991"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR014722"
FT                   /db_xref="InterPro:IPR014726"
FT                   /db_xref="InterPro:IPR022666"
FT                   /db_xref="InterPro:IPR022669"
FT                   /db_xref="InterPro:IPR022671"
FT                   /db_xref="UniProtKB/Swiss-Prot:A5IHR1"
FT                   /protein_id="ABQ56911.1"
FT                   /translation="MALLKSKPTSPGKRGEIRVVHHDIYKGKPHAALVEKLKKTGGRNN
FT                   QGRITVRHIGGGQRQKYRIIDFKRNKDGILGRVERLEYDPNRTALIALISYKDGEKRYI
FT                   IAPSNLEVGATIQSGADSPISVGNCLPLKNIPVGTTIHCVEMKPGKGAQMLRSAGCSGQ
FT                   LVAKEGVYATLRLRSGEMRKIHVLCRAVIGEVSNSEHNLRALGKAGAKRWRGIRPTVRG
FT                   VAMNPVDHPHGGGEGRTSGGRHPVSPWGLPTKGYKTRSNKRTDTFIVRGRKKK"
     MALLKSKPTS PGKRGEIRVV HHDIYKGKPH AALVEKLKKT GGRNNQGRIT VRHIGGGQRQ        60
     KYRIIDFKRN KDGILGRVER LEYDPNRTAL IALISYKDGE KRYIIAPSNL EVGATIQSGA       120
     DSPISVGNCL PLKNIPVGTT IHCVEMKPGK GAQMLRSAGC SGQLVAKEGV YATLRLRSGE       180
     MRKIHVLCRA VIGEVSNSEH NLRALGKAGA KRWRGIRPTV RGVAMNPVDH PHGGGEGRTS       240
     GGRHPVSPWG LPTKGYKTRS NKRTDTFIVR GRKKK                                  275
//

If you have problems or comments...

PBIL Back to PBIL home page