(data stored in ACNUC7421 zone)

EMBL: CP000675.RPLC

CP000675.RPLC        Location/Qualifiers
FT   CDS             437174..437824
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplC"
FT                   /locus_tag="LPC_3013"
FT                   /product="50S ribosomal protein L3"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_3013"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ56914"
FT                   /db_xref="GOA:A5IHR4"
FT                   /db_xref="InterPro:IPR000597"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR019926"
FT                   /db_xref="InterPro:IPR019927"
FT                   /db_xref="UniProtKB/Swiss-Prot:A5IHR4"
FT                   /protein_id="ABQ56914.1"
FT                   /translation="MMIGLLGRKIGMTRVFTPEGVSVPVSVVEVQPNRVSQVKTAANDG
FT                   YSAVQLTGGTKKSSKVSKPVAGHFAKAQIDAGDMQVEFRIDSEDAFTPGQVISVADVFT
FT                   AGQYVDVSGLTKGKGFAGTVKRHNFRTQDASHGNSRSHRVPGSIGQNQTPGRVFKGKKM
FT                   AGHMGNARCTIQSLELVKVDSERNLLLIKGAIPGAPGSRVEIKPAVKKQARGE"
     MMIGLLGRKI GMTRVFTPEG VSVPVSVVEV QPNRVSQVKT AANDGYSAVQ LTGGTKKSSK        60
     VSKPVAGHFA KAQIDAGDMQ VEFRIDSEDA FTPGQVISVA DVFTAGQYVD VSGLTKGKGF       120
     AGTVKRHNFR TQDASHGNSR SHRVPGSIGQ NQTPGRVFKG KKMAGHMGNA RCTIQSLELV       180
     KVDSERNLLL IKGAIPGAPG SRVEIKPAVK KQARGE                                 216
//

If you have problems or comments...

PBIL Back to PBIL home page