(data stored in ACNUC7421 zone)

EMBL: CP000675.RPLE

CP000675.RPLE        Location/Qualifiers
FT   CDS             442554..443105
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplE"
FT                   /locus_tag="LPC_3001"
FT                   /product="50S ribosomal protein L5"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_3001"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ56902"
FT                   /db_xref="GOA:A5IHQ2"
FT                   /db_xref="InterPro:IPR002132"
FT                   /db_xref="InterPro:IPR020929"
FT                   /db_xref="InterPro:IPR020930"
FT                   /db_xref="InterPro:IPR022803"
FT                   /db_xref="InterPro:IPR031309"
FT                   /db_xref="InterPro:IPR031310"
FT                   /db_xref="UniProtKB/Swiss-Prot:A5IHQ2"
FT                   /protein_id="ABQ56902.1"
FT                   /translation="MARLKEFYKKDVVTMMMKRFNYSSVMEVPRILKITLNMGVGEAVG
FT                   DKKVMNHAIEDMTLISGQKPVVTKARKSIAGFKIREGWPIGCKVTLRRERMYEFLDRLI
FT                   SITLPRVRDFRGLNPKSFDGTGNYSMGIHEQIVFPEIDYDKTDGIRGLDICITTSAKTN
FT                   EEAKALLEAFNLPLKDKDRK"
     MARLKEFYKK DVVTMMMKRF NYSSVMEVPR ILKITLNMGV GEAVGDKKVM NHAIEDMTLI        60
     SGQKPVVTKA RKSIAGFKIR EGWPIGCKVT LRRERMYEFL DRLISITLPR VRDFRGLNPK       120
     SFDGTGNYSM GIHEQIVFPE IDYDKTDGIR GLDICITTSA KTNEEAKALL EAFNLPLKDK       180
     DRK                                                                     183
//

If you have problems or comments...

PBIL Back to PBIL home page