(data stored in ACNUC7421 zone)

EMBL: CP000675.RPLF

CP000675.RPLF        Location/Qualifiers
FT   CDS             443856..444395
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplF"
FT                   /locus_tag="LPC_2998"
FT                   /product="50S ribosomal protein L6/(L9E)"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_2998"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ56899"
FT                   /db_xref="GOA:A5IHP9"
FT                   /db_xref="InterPro:IPR000702"
FT                   /db_xref="InterPro:IPR002358"
FT                   /db_xref="InterPro:IPR019906"
FT                   /db_xref="InterPro:IPR020040"
FT                   /db_xref="InterPro:IPR036789"
FT                   /db_xref="UniProtKB/Swiss-Prot:A5IHP9"
FT                   /protein_id="ABQ56899.1"
FT                   /translation="MSRVAKAPVIHSANVEVTFVDGVITVKGPKGILTQKINKLVNIQH
FT                   SKESNKLEFSPASNDPMGWAQAGTARALVRNMVQGVTEGYTVTLELVGVGYRAQSKDKS
FT                   ISLSLGYSHSIEYDLPKGVTVETPNNTTILLKGVDKQVLGQIASEIRAFRPPEPYKGKG
FT                   VKYAGEQIVRKEAKKK"
     MSRVAKAPVI HSANVEVTFV DGVITVKGPK GILTQKINKL VNIQHSKESN KLEFSPASND        60
     PMGWAQAGTA RALVRNMVQG VTEGYTVTLE LVGVGYRAQS KDKSISLSLG YSHSIEYDLP       120
     KGVTVETPNN TTILLKGVDK QVLGQIASEI RAFRPPEPYK GKGVKYAGEQ IVRKEAKKK        179
//

If you have problems or comments...

PBIL Back to PBIL home page