(data stored in ACNUC7421 zone)

EMBL: CP000675.RPLL

CP000675.RPLL        Location/Qualifiers
FT   CDS             423592..423972
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplL"
FT                   /locus_tag="LPC_3022"
FT                   /product="50S ribosomal protein L7/L12"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_3022"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ56922"
FT                   /db_xref="GOA:A5IHS2"
FT                   /db_xref="InterPro:IPR000206"
FT                   /db_xref="InterPro:IPR008932"
FT                   /db_xref="InterPro:IPR013823"
FT                   /db_xref="InterPro:IPR014719"
FT                   /db_xref="InterPro:IPR036235"
FT                   /db_xref="UniProtKB/Swiss-Prot:A5IHS2"
FT                   /protein_id="ABQ56922.1"
FT                   /translation="MAVSKNEILETISNMTVMEVVELIEAMEEKFNVSAAAAAVAVAAP
FT                   AAGAGAAAAEEQTEFTVVMTSFGSNKVNVIKAIRGITGLGLKEAKDLVEGAPSTVKEGV
FT                   SKDEAASIKKELEEAGATVEVK"
     MAVSKNEILE TISNMTVMEV VELIEAMEEK FNVSAAAAAV AVAAPAAGAG AAAAEEQTEF        60
     TVVMTSFGSN KVNVIKAIRG ITGLGLKEAK DLVEGAPSTV KEGVSKDEAA SIKKELEEAG       120
     ATVEVK                                                                  126
//

If you have problems or comments...

PBIL Back to PBIL home page