(data stored in ACNUC7421 zone)

EMBL: CP000675.RPLN

CP000675.RPLN        Location/Qualifiers
FT   CDS             441831..442196
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplN"
FT                   /locus_tag="LPC_3003"
FT                   /product="50S ribosomal protein L14"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_3003"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ56904"
FT                   /db_xref="GOA:A5IHQ4"
FT                   /db_xref="InterPro:IPR000218"
FT                   /db_xref="InterPro:IPR005745"
FT                   /db_xref="InterPro:IPR019972"
FT                   /db_xref="InterPro:IPR036853"
FT                   /db_xref="UniProtKB/Swiss-Prot:A5IHQ4"
FT                   /protein_id="ABQ56904.1"
FT                   /translation="MIQMQTVLEVADNSGARKVMCIKVLGGSHRRYARVGDVIKVGVKD
FT                   AIPRSKVKKGAVMRAVVVRTAQGVRRDDGSLIRFDDNAAVLLNNQNEPIGTRIFGPVTR
FT                   ELRERFMKIISLAAEVL"
     MIQMQTVLEV ADNSGARKVM CIKVLGGSHR RYARVGDVIK VGVKDAIPRS KVKKGAVMRA        60
     VVVRTAQGVR RDDGSLIRFD DNAAVLLNNQ NEPIGTRIFG PVTRELRERF MKIISLAAEV       120
     L                                                                       121
//

If you have problems or comments...

PBIL Back to PBIL home page