(data stored in ACNUC7421 zone)

EMBL: CP000675.RPLP

CP000675.RPLP        Location/Qualifiers
FT   CDS             440879..441292
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplP"
FT                   /locus_tag="LPC_3006"
FT                   /product="50S ribosomal protein L16/(L10E)"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_3006"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ56907"
FT                   /db_xref="GOA:A5IHQ7"
FT                   /db_xref="InterPro:IPR000114"
FT                   /db_xref="InterPro:IPR016180"
FT                   /db_xref="InterPro:IPR020798"
FT                   /db_xref="InterPro:IPR036920"
FT                   /db_xref="UniProtKB/Swiss-Prot:A5IHQ7"
FT                   /protein_id="ABQ56907.1"
FT                   /translation="MLQPKRTKYRKQMKGRNRGLALRGSKISFGEFGLKAVERGRLTAR
FT                   QIEAARRAMTRHIKRGGKIWIRVFPDKPITQKPLEVRQGKGKGSVEYWVAQIQPGKVLF
FT                   EMEGVSKELAMEAFDLAKAKLPFKVMFEERTVM"
     MLQPKRTKYR KQMKGRNRGL ALRGSKISFG EFGLKAVERG RLTARQIEAA RRAMTRHIKR        60
     GGKIWIRVFP DKPITQKPLE VRQGKGKGSV EYWVAQIQPG KVLFEMEGVS KELAMEAFDL       120
     AKAKLPFKVM FEERTVM                                                      137
//

If you have problems or comments...

PBIL Back to PBIL home page