(data stored in ACNUC7421 zone)

EMBL: CP000675.RPLR

CP000675.RPLR        Location/Qualifiers
FT   CDS             444406..444765
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplR"
FT                   /locus_tag="LPC_2997"
FT                   /product="50S ribosomal protein L18"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_2997"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ56898"
FT                   /db_xref="GOA:A5IHP8"
FT                   /db_xref="InterPro:IPR004389"
FT                   /db_xref="InterPro:IPR005484"
FT                   /db_xref="UniProtKB/Swiss-Prot:A5IHP8"
FT                   /protein_id="ABQ56898.1"
FT                   /translation="MNKQNARHRRGLKAKALIRKTGRSRLVVYRSGVHIYSQIVKSDQL
FT                   GDKVLVASSTIDKELRSSLTGKSKVEQASLVGQLLGKRAKAAGITQVAFDRAGYKYHGR
FT                   VKALAEGAREAGLDF"
     MNKQNARHRR GLKAKALIRK TGRSRLVVYR SGVHIYSQIV KSDQLGDKVL VASSTIDKEL        60
     RSSLTGKSKV EQASLVGQLL GKRAKAAGIT QVAFDRAGYK YHGRVKALAE GAREAGLDF        119
//

If you have problems or comments...

PBIL Back to PBIL home page