(data stored in ACNUC7421 zone)

EMBL: CP000675.RPOA

CP000675.RPOA        Location/Qualifiers
FT   CDS             448876..449868
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpoA"
FT                   /locus_tag="LPC_2990"
FT                   /product="DNA-directed RNA polymerase alpha subunit RpoA"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_2990"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ56891"
FT                   /db_xref="GOA:A5IHP1"
FT                   /db_xref="InterPro:IPR011260"
FT                   /db_xref="InterPro:IPR011262"
FT                   /db_xref="InterPro:IPR011263"
FT                   /db_xref="InterPro:IPR011773"
FT                   /db_xref="InterPro:IPR036603"
FT                   /db_xref="InterPro:IPR036643"
FT                   /db_xref="UniProtKB/Swiss-Prot:A5IHP1"
FT                   /protein_id="ABQ56891.1"
FT                   /translation="MYTEINEMLTPKVLKVQAESPYKARIVLEPLERGFGHTLGNALRR
FT                   ILLSSMPGSAITEASIDGVLHEYSTIEGVQEDVVDLLLNLKSVAIKLTVGNEAQVTLNK
FT                   EGPCQVTAGDIQLTHGQEIINPELVIANLNEKGKLNMTLKVERGIGFHNTDAFVRYHED
FT                   EIEKKTVGKLKIDNSFSPVKKVAYFVDSARVENRTDLDKLTIELETNGTIDAEEAIRIS
FT                   ASILQRQLHAFVDMKFEESRADNKERNDFDPVLLRSVDDLELTVRSANCLKAENIHYIG
FT                   DLVQRTESELLKTPNLGKKSLTEIKDVLASRSLSLGMKLENWPPASLGE"
     MYTEINEMLT PKVLKVQAES PYKARIVLEP LERGFGHTLG NALRRILLSS MPGSAITEAS        60
     IDGVLHEYST IEGVQEDVVD LLLNLKSVAI KLTVGNEAQV TLNKEGPCQV TAGDIQLTHG       120
     QEIINPELVI ANLNEKGKLN MTLKVERGIG FHNTDAFVRY HEDEIEKKTV GKLKIDNSFS       180
     PVKKVAYFVD SARVENRTDL DKLTIELETN GTIDAEEAIR ISASILQRQL HAFVDMKFEE       240
     SRADNKERND FDPVLLRSVD DLELTVRSAN CLKAENIHYI GDLVQRTESE LLKTPNLGKK       300
     SLTEIKDVLA SRSLSLGMKL ENWPPASLGE                                        330
//

If you have problems or comments...

PBIL Back to PBIL home page