(data stored in ACNUC7421 zone)

EMBL: CP000675.RPOB

CP000675.RPOB        Location/Qualifiers
FT   CDS             424064..428170
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpoB"
FT                   /locus_tag="LPC_3021"
FT                   /product="DNA-directed RNA polymerase beta subunit"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_3021"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ56921"
FT                   /db_xref="GOA:A5IHS1"
FT                   /db_xref="InterPro:IPR007120"
FT                   /db_xref="InterPro:IPR007121"
FT                   /db_xref="InterPro:IPR007641"
FT                   /db_xref="InterPro:IPR007642"
FT                   /db_xref="InterPro:IPR007644"
FT                   /db_xref="InterPro:IPR007645"
FT                   /db_xref="InterPro:IPR010243"
FT                   /db_xref="InterPro:IPR014724"
FT                   /db_xref="InterPro:IPR015712"
FT                   /db_xref="InterPro:IPR019462"
FT                   /db_xref="InterPro:IPR037033"
FT                   /db_xref="InterPro:IPR037034"
FT                   /db_xref="UniProtKB/Swiss-Prot:A5IHS1"
FT                   /protein_id="ABQ56921.1"
FT                   /translation="MAVAEAKPQYSHAEKKRFRKSFGKQTDIMPIPNLLEIQLKSYRDF
FT                   LQTDTKLSEQLNTGLHAAFSSVFPIESFSGNARLEYVGYKLGEPAFDVRECKLRGLTYS
FT                   APLRVKIRLVVLDKDASDDPKPIKDIREQDVFMGEIPLMTDVGTFVVNGTERVVVSQLH
FT                   RSPGVIFEHDKGKTHSSGKLLYSARIIPYRGSWLDFEFDPKDCVYVRIDRRRKLPVTIL
FT                   LRALGYEAEDILSEFFETTRCHLKNGEYHIDLIPQRLRGEIASFDIHVPETGELIVEQG
FT                   RRITARHIKQMEKSQMQDLVVPRDYLIGKTLAKNIIDTSTGEFLAQANDEITEELLDAM
FT                   ANHGILQIDMIYTNDLDHGSYISDTLKIDPTGSQLEALVEIYRMMRPGEPPTKEAAEAL
FT                   FKNLFFVEERYDLSAVGRMKFNRRVGIKSDEGPGTLTKEDILSVIKTLIDIRNGIGMVD
FT                   DIDHLGNRRVRSVGEMTENQFRVGLVRVERAVKERLSLVESENLMPQDLINAKPVSAAI
FT                   KEFFGSSQLSQFMDQVNPLSGVTHKRRVSALGPGGLTRERAGFEVRDVHTTHYGRVCPI
FT                   ETPEGPNIGLINSLSVYARTNEYGFIETPCRKVVNGRVTDEVEYLSAIEEVDQYIAQSN
FT                   VELDAQGNILADLVPCRHQNEFSLTTPDKINYMDVSPKQIVSVAASLIPFLEHDDANRA
FT                   LMGSNMQRQAVPTLRSEKPLVGTGMERIVASDSGVSVVAKRGGVIDLVDASRIVVRVND
FT                   DETTAGETGVDIYNLTKYFRSNQDTCINQRPIVSTGDRIQRGDVLADGPCTDMGELALG
FT                   QNLLVAFMPWNGYNFEDSILISERIVHDDRFTTIHIEELTCIARDTKLGTEEITADIPN
FT                   VGESALSNLDESGVVYIGAEVKAGDILVGKVTPKGETQLTPEEKLLRAIFGEKASDVKD
FT                   SSLRVPSGMNGTVIDVQVFTRDGLEKDARAKSIEEEHLARVRKDLIDERRIREEDIYHR
FT                   VSHLLLDKVATGGPGSLKPGSKITQDYLDKVEREKWFDIRIEDDAVSQQLEQLSKQLEL
FT                   LTKEMEKRFNDSRKKIIQGDDLAPGVLKIVKVYLAVKRRIQPGDKMAGRHGNKGVISIV
FT                   VPVEDMPHMEDGTAVDIVLNPLGVPSRMNIGQVLETHLGLAAKGLGRKIAQMLDERQTP
FT                   EAIKAYLEKIYNHDGVQRVNLKCLNDDELMTLADNLRAGVPMATPVFDGATEQEIKSML
FT                   QLADLPADGKTVLIDGRTGNKFDNPVTVGYMYMLKLNHLVDDKMHARSTGSYSLVTQQP
FT                   LGGKAQFGGQRFGEMEVWALEAYGAAYTLQEMLTVKSDDVGGRTKIYKNIVDGDHRMDP
FT                   GMPESFNVLLKEIRALGIDIELEHD"
     MAVAEAKPQY SHAEKKRFRK SFGKQTDIMP IPNLLEIQLK SYRDFLQTDT KLSEQLNTGL        60
     HAAFSSVFPI ESFSGNARLE YVGYKLGEPA FDVRECKLRG LTYSAPLRVK IRLVVLDKDA       120
     SDDPKPIKDI REQDVFMGEI PLMTDVGTFV VNGTERVVVS QLHRSPGVIF EHDKGKTHSS       180
     GKLLYSARII PYRGSWLDFE FDPKDCVYVR IDRRRKLPVT ILLRALGYEA EDILSEFFET       240
     TRCHLKNGEY HIDLIPQRLR GEIASFDIHV PETGELIVEQ GRRITARHIK QMEKSQMQDL       300
     VVPRDYLIGK TLAKNIIDTS TGEFLAQAND EITEELLDAM ANHGILQIDM IYTNDLDHGS       360
     YISDTLKIDP TGSQLEALVE IYRMMRPGEP PTKEAAEALF KNLFFVEERY DLSAVGRMKF       420
     NRRVGIKSDE GPGTLTKEDI LSVIKTLIDI RNGIGMVDDI DHLGNRRVRS VGEMTENQFR       480
     VGLVRVERAV KERLSLVESE NLMPQDLINA KPVSAAIKEF FGSSQLSQFM DQVNPLSGVT       540
     HKRRVSALGP GGLTRERAGF EVRDVHTTHY GRVCPIETPE GPNIGLINSL SVYARTNEYG       600
     FIETPCRKVV NGRVTDEVEY LSAIEEVDQY IAQSNVELDA QGNILADLVP CRHQNEFSLT       660
     TPDKINYMDV SPKQIVSVAA SLIPFLEHDD ANRALMGSNM QRQAVPTLRS EKPLVGTGME       720
     RIVASDSGVS VVAKRGGVID LVDASRIVVR VNDDETTAGE TGVDIYNLTK YFRSNQDTCI       780
     NQRPIVSTGD RIQRGDVLAD GPCTDMGELA LGQNLLVAFM PWNGYNFEDS ILISERIVHD       840
     DRFTTIHIEE LTCIARDTKL GTEEITADIP NVGESALSNL DESGVVYIGA EVKAGDILVG       900
     KVTPKGETQL TPEEKLLRAI FGEKASDVKD SSLRVPSGMN GTVIDVQVFT RDGLEKDARA       960
     KSIEEEHLAR VRKDLIDERR IREEDIYHRV SHLLLDKVAT GGPGSLKPGS KITQDYLDKV      1020
     EREKWFDIRI EDDAVSQQLE QLSKQLELLT KEMEKRFNDS RKKIIQGDDL APGVLKIVKV      1080
     YLAVKRRIQP GDKMAGRHGN KGVISIVVPV EDMPHMEDGT AVDIVLNPLG VPSRMNIGQV      1140
     LETHLGLAAK GLGRKIAQML DERQTPEAIK AYLEKIYNHD GVQRVNLKCL NDDELMTLAD      1200
     NLRAGVPMAT PVFDGATEQE IKSMLQLADL PADGKTVLID GRTGNKFDNP VTVGYMYMLK      1260
     LNHLVDDKMH ARSTGSYSLV TQQPLGGKAQ FGGQRFGEME VWALEAYGAA YTLQEMLTVK      1320
     SDDVGGRTKI YKNIVDGDHR MDPGMPESFN VLLKEIRALG IDIELEHD                   1368
//

If you have problems or comments...

PBIL Back to PBIL home page