(data stored in ACNUC7421 zone)

EMBL: CP000675.RPSD

CP000675.RPSD        Location/Qualifiers
FT   CDS             448237..448857
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsD"
FT                   /locus_tag="LPC_2991"
FT                   /product="30S ribosomal protein S4"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_2991"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ56892"
FT                   /db_xref="GOA:A5IHP2"
FT                   /db_xref="InterPro:IPR001912"
FT                   /db_xref="InterPro:IPR002942"
FT                   /db_xref="InterPro:IPR005709"
FT                   /db_xref="InterPro:IPR018079"
FT                   /db_xref="InterPro:IPR022801"
FT                   /db_xref="InterPro:IPR036986"
FT                   /db_xref="UniProtKB/Swiss-Prot:A5IHP2"
FT                   /protein_id="ABQ56892.1"
FT                   /translation="MARYLGPKCKLSRREGCDLLLKSGVRDHKSKCKSEKLPGQHGDKK
FT                   PRLNSYGIQLREKQKIRRLYGILEKQFRNYYKKAARQKGSTGENLMALLERRLDNVVYR
FT                   MGFASTRAEARQLVAHKAILVNDKVVNVPSFLVNPGDTVSVRQKAKNQGRIQAALALSE
FT                   QRAPCDWITVDTGSFKGTFSTAPTLMDLSSDYNVNLVVELYSK"
     MARYLGPKCK LSRREGCDLL LKSGVRDHKS KCKSEKLPGQ HGDKKPRLNS YGIQLREKQK        60
     IRRLYGILEK QFRNYYKKAA RQKGSTGENL MALLERRLDN VVYRMGFAST RAEARQLVAH       120
     KAILVNDKVV NVPSFLVNPG DTVSVRQKAK NQGRIQAALA LSEQRAPCDW ITVDTGSFKG       180
     TFSTAPTLMD LSSDYNVNLV VELYSK                                            206
//

If you have problems or comments...

PBIL Back to PBIL home page