(data stored in ACNUC7421 zone)

EMBL: CP000675.RPSJ

CP000675.RPSJ        Location/Qualifiers
FT   CDS             436822..437139
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsJ"
FT                   /locus_tag="LPC_3014"
FT                   /product="30S ribosomal protein S10"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_3014"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ56915"
FT                   /db_xref="GOA:A5IHR5"
FT                   /db_xref="InterPro:IPR001848"
FT                   /db_xref="InterPro:IPR027486"
FT                   /db_xref="InterPro:IPR036838"
FT                   /db_xref="UniProtKB/Swiss-Prot:A5IHR5"
FT                   /protein_id="ABQ56915.1"
FT                   /translation="MSSNQNIKIRLKSFDHRLIDLSTREIVDTAKRTGAQIRGPIPLPI
FT                   RKEKFTVLTSPHVNKDARDQYELRTHKRLVVIVHPTEKTVDALMKLDLAAGVDVQISLD
FT                   D"
     MSSNQNIKIR LKSFDHRLID LSTREIVDTA KRTGAQIRGP IPLPIRKEKF TVLTSPHVNK        60
     DARDQYELRT HKRLVVIVHP TEKTVDALMK LDLAAGVDVQ ISLDD                       105
//

If you have problems or comments...

PBIL Back to PBIL home page