(data stored in ACNUC7421 zone)

EMBL: CP000675.RPSN

CP000675.RPSN        Location/Qualifiers
FT   CDS             443118..443420
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsN"
FT                   /locus_tag="LPC_3000"
FT                   /product="30S ribosomal protein S14"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_3000"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ56901"
FT                   /protein_id="ABQ56901.1"
FT                   /translation="MAKKSMLMRESKRAKLVEKYRQRRNELKQLIKSSDDFQVIMESQA
FT                   KLAKLPVNSNPVRYVTRCKQCGRPHAVYRKFNLCRICLRQQLMVGNIPGGRKSSW"
     MAKKSMLMRE SKRAKLVEKY RQRRNELKQL IKSSDDFQVI MESQAKLAKL PVNSNPVRYV        60
     TRCKQCGRPH AVYRKFNLCR ICLRQQLMVG NIPGGRKSSW                             100
//

If you have problems or comments...

PBIL Back to PBIL home page