(data stored in ACNUC7421 zone)

EMBL: CP000675.RPSP

CP000675.RPSP        Location/Qualifiers
FT   CDS             complement(492209..492469)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsP"
FT                   /locus_tag="LPC_2944"
FT                   /product="30S ribosomal protein S16"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_2944"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ56845"
FT                   /db_xref="GOA:A5IHJ5"
FT                   /db_xref="InterPro:IPR000307"
FT                   /db_xref="InterPro:IPR020592"
FT                   /db_xref="InterPro:IPR023803"
FT                   /db_xref="UniProtKB/Swiss-Prot:A5IHJ5"
FT                   /protein_id="ABQ56845.1"
FT                   /translation="MVVIRLSRAGAKKRPFYHMVVTDSRKRRDGNYIERIGYFNPVARG
FT                   QEVKLHIDMDKMTHWQKVGAQLSDRVSALLKEHSKKSETAA"
     MVVIRLSRAG AKKRPFYHMV VTDSRKRRDG NYIERIGYFN PVARGQEVKL HIDMDKMTHW        60
     QKVGAQLSDR VSALLKEHSK KSETAA                                             86
//

If you have problems or comments...

PBIL Back to PBIL home page