(data stored in ACNUC7421 zone)

EMBL: CP000675.RRE41

CP000675.RRE41       Location/Qualifiers
FT   CDS             35068..37986
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rre41"
FT                   /locus_tag="LPC_0030"
FT                   /product="sensory box (GGDEF/EAL domain) regulatory
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_0030"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ54030"
FT                   /protein_id="ABQ54030.1"
FT                   /translation="MRKSKKPHPLNHIASGDNFSHLNLLERSLISQLIELSYEENTLHT
FT                   LSLSGLELLGKHPLLKDTITAVWHHDGSHINILASNGLKFDAPKELEKFLAVVSDWHFL
FT                   KIYKTKLKKHSEEKLKQRIDICLDKCQGNLFCISFWFDSIDCNFEILMPFFKDILGILN
FT                   LSLAKLMNKKREKLLTTILEKAGDSVEITNEEAVIQYVNPAFENITLYNAREAINKTVA
FT                   SLLRSPVEDAQLFEEINQTLKSGNTWKGQIRSRKKDGSYWVAQTIIVPVMDDELGRITQ
FT                   HIAIKQDITEQVHRFNQLKISEERYRNLMNAVADGIFIHNLQGAFLEVNEAACLSLNYS
FT                   REELINSYVWDIEVGFSQESLNQLWENVQKGPINTEGMHRRKDGTIFPVDVRLAVFNAT
FT                   GEKLVLAIVRDITLQKRSEATIRKLTRALEQSPVLVIITDKTGTIEYVNAKVIEQTGYR
FT                   KEELVGGNTRILRSGQTPHEIYKTMWEHLANGEEWHGELLNKNKSGEHFWVSAIISPIR
FT                   NENEEITHYLAVMEDVTQKKSYEEMLKHQATFDNLTNLPNRLYAVNKLERAISKSHINN
FT                   QKLAVLFLDLDEFKQINDSLGHAIGDLLLKALSERFLSMIRQTDTIARLGGDEFMMILE
FT                   NIMQDKDAESIAKKCREICSQPFVIESQELLVSTSIGIAIYPDHGKDAKTLMRNADTAM
FT                   YQSKIRGKNNWTVFQKTMIDGANNHIRIKTELHQAFTRNELYICYQPIIDLKENKVVAA
FT                   EALLRWQNTTLGQINPDQIISLAEETGMIIPLGYWILDKVCTQAKEWEFITGSKIKVAV
FT                   NISTLQLKQKDFIHKVQLILKRTKLSADSLIFEVTESAFIDDSKFILSQLNKLSDIGIH
FT                   FSLDDFGVGYSFLQYIKSYPFKNLKIDRVFIQGVNTNHNQLSLINSIITMARNLKLSVI
FT                   AEGIETAEQLELMRSMNCDMVQGWYFSKPLSGDKFLFFLMNK"
     MRKSKKPHPL NHIASGDNFS HLNLLERSLI SQLIELSYEE NTLHTLSLSG LELLGKHPLL        60
     KDTITAVWHH DGSHINILAS NGLKFDAPKE LEKFLAVVSD WHFLKIYKTK LKKHSEEKLK       120
     QRIDICLDKC QGNLFCISFW FDSIDCNFEI LMPFFKDILG ILNLSLAKLM NKKREKLLTT       180
     ILEKAGDSVE ITNEEAVIQY VNPAFENITL YNAREAINKT VASLLRSPVE DAQLFEEINQ       240
     TLKSGNTWKG QIRSRKKDGS YWVAQTIIVP VMDDELGRIT QHIAIKQDIT EQVHRFNQLK       300
     ISEERYRNLM NAVADGIFIH NLQGAFLEVN EAACLSLNYS REELINSYVW DIEVGFSQES       360
     LNQLWENVQK GPINTEGMHR RKDGTIFPVD VRLAVFNATG EKLVLAIVRD ITLQKRSEAT       420
     IRKLTRALEQ SPVLVIITDK TGTIEYVNAK VIEQTGYRKE ELVGGNTRIL RSGQTPHEIY       480
     KTMWEHLANG EEWHGELLNK NKSGEHFWVS AIISPIRNEN EEITHYLAVM EDVTQKKSYE       540
     EMLKHQATFD NLTNLPNRLY AVNKLERAIS KSHINNQKLA VLFLDLDEFK QINDSLGHAI       600
     GDLLLKALSE RFLSMIRQTD TIARLGGDEF MMILENIMQD KDAESIAKKC REICSQPFVI       660
     ESQELLVSTS IGIAIYPDHG KDAKTLMRNA DTAMYQSKIR GKNNWTVFQK TMIDGANNHI       720
     RIKTELHQAF TRNELYICYQ PIIDLKENKV VAAEALLRWQ NTTLGQINPD QIISLAEETG       780
     MIIPLGYWIL DKVCTQAKEW EFITGSKIKV AVNISTLQLK QKDFIHKVQL ILKRTKLSAD       840
     SLIFEVTESA FIDDSKFILS QLNKLSDIGI HFSLDDFGVG YSFLQYIKSY PFKNLKIDRV       900
     FIQGVNTNHN QLSLINSIIT MARNLKLSVI AEGIETAEQL ELMRSMNCDM VQGWYFSKPL       960
     SGDKFLFFLM NK                                                           972
//

If you have problems or comments...

PBIL Back to PBIL home page