(data stored in ACNUC7421 zone)

EMBL: CP000675.SDBA

CP000675.SDBA        Location/Qualifiers
FT   CDS             378239..380812
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="sdbA"
FT                   /locus_tag="LPC_0352"
FT                   /product="SdbA protein, putative substrate of the Dot/Icm
FT                   system"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_0352"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ54347"
FT                   /protein_id="ABQ54347.1"
FT                   /translation="MDYSRGLVWTENNLVDDILAQVQRLISLGADPKNICLDGMCIGGA
FT                   VATIAAAKLHEKGMKVKLNNERSFTSLSSLVFGFIVPELQTANWWSPLTYGRFLLAGVV
FT                   YALLTPLIWLAGWPVDVTKAWNRIPAQDKMYSVVRDKDNGLYDGVIHDHFCSIASLVDS
FT                   QINSILYKLSTDQLLTEEEKQILCDDQLSHHFKPSQSVLKNPKYKGPHFISRQDLVAEL
FT                   GHREEYTNHDYFLDRLREKFQLDRTIRPVALAEDGEKDIDGIPPQLSNHKERPLIIASS
FT                   GGTGHISATHGIINDLQSKTDNVVITQHHAELYKNKPFSITSVLIRIGVWLTSLPVLED
FT                   ILKGVMRFIGYPVLPSSSIFWDQMSKIQQSETKKENGIETGRTRPYVDMLLDIYPEGYE
FT                   YTAFNNATHLTSSIEDIQTMISFKGHVEEDNRNIVYQNILQRLMHAAKQSTPYTRLIST
FT                   QALSLGAICDAVKYYNTVFLPVYNAERGTSYQPITIDQYMTDLPSLGCIHFMNNLEELT
FT                   SEQRQLMEIHAVNMSEPFKEAHFGKEQGFKAVHNIDPRNNPMIRNAFKDLSLTKYLDKT
FT                   QSFDLHFNVYKKEKQNALPVLNGKEKITIKPHAKIASIMIGSLAANASADYAQYLLNQG
FT                   YDHIFLFGGLNDSIAARIDQIINSYPDSRHDEIRKKIILLGNQSDVEMAPIMTRSNCVV
FT                   IRGGGLSVMEQMAMPIMDEKIVLLHHEDNEEGPLTSGLSWEDGNADKLIEYLSEKGAYA
FT                   KKTSPGLCSGHLNEAEKDFEKKYITQLKSKGTKEKVDLTIPQQKKPPLKKEWGRKTGYT
FT                   ELGHVLSHQHRFFETIPEVREPFCSKEDLHHHELSSQSLVSVTVG"
     MDYSRGLVWT ENNLVDDILA QVQRLISLGA DPKNICLDGM CIGGAVATIA AAKLHEKGMK        60
     VKLNNERSFT SLSSLVFGFI VPELQTANWW SPLTYGRFLL AGVVYALLTP LIWLAGWPVD       120
     VTKAWNRIPA QDKMYSVVRD KDNGLYDGVI HDHFCSIASL VDSQINSILY KLSTDQLLTE       180
     EEKQILCDDQ LSHHFKPSQS VLKNPKYKGP HFISRQDLVA ELGHREEYTN HDYFLDRLRE       240
     KFQLDRTIRP VALAEDGEKD IDGIPPQLSN HKERPLIIAS SGGTGHISAT HGIINDLQSK       300
     TDNVVITQHH AELYKNKPFS ITSVLIRIGV WLTSLPVLED ILKGVMRFIG YPVLPSSSIF       360
     WDQMSKIQQS ETKKENGIET GRTRPYVDML LDIYPEGYEY TAFNNATHLT SSIEDIQTMI       420
     SFKGHVEEDN RNIVYQNILQ RLMHAAKQST PYTRLISTQA LSLGAICDAV KYYNTVFLPV       480
     YNAERGTSYQ PITIDQYMTD LPSLGCIHFM NNLEELTSEQ RQLMEIHAVN MSEPFKEAHF       540
     GKEQGFKAVH NIDPRNNPMI RNAFKDLSLT KYLDKTQSFD LHFNVYKKEK QNALPVLNGK       600
     EKITIKPHAK IASIMIGSLA ANASADYAQY LLNQGYDHIF LFGGLNDSIA ARIDQIINSY       660
     PDSRHDEIRK KIILLGNQSD VEMAPIMTRS NCVVIRGGGL SVMEQMAMPI MDEKIVLLHH       720
     EDNEEGPLTS GLSWEDGNAD KLIEYLSEKG AYAKKTSPGL CSGHLNEAEK DFEKKYITQL       780
     KSKGTKEKVD LTIPQQKKPP LKKEWGRKTG YTELGHVLSH QHRFFETIPE VREPFCSKED       840
     LHHHELSSQS LVSVTVG                                                      857
//

If you have problems or comments...

PBIL Back to PBIL home page