(data stored in ACNUC7421 zone)

EMBL: CP000675.SDHA

CP000675.SDHA        Location/Qualifiers
FT   CDS             complement(468751..473040)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="sdhA"
FT                   /locus_tag="LPC_2967"
FT                   /product="SdhA, substrate of the Dot/Icm system"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_2967"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ56868"
FT                   /protein_id="ABQ56868.1"
FT                   /translation="MISEKIKLLESFKQNQFSKLIEKINSKILATLKSGHFNPRLAPYL
FT                   EKMNKDGVPFTDFDLDPENISQIKKLINALYHARLAFLDLENIDIGNIKRTIPDLKLLY
FT                   SNTIHQAYQAGYLITNLDVDLQEMFKEEIDLILPVIGKLQAFAGEHQECTKHLAESLKD
FT                   FPISYKAGEVTGIALEQMQPRTGDWDYQFLTQFSAVLPGYIEKLTQYIQQYSSQIKEKE
FT                   PTLNNEKLEELQNASLKLLNDLEHLKGNDFFISLKVLKYIHIIRNIITLATSSVEQMGH
FT                   FSDSSQDVIRDNLAQLKYVVLPTLFGLVDKIEDNAMLKPGTLSIPLMEKIKPLYQLLIY
FT                   YASKPVNFKEKGEELLSIEDSRFLALRLERTYQRIDEANKALFKIQKAQEALDNFYKIL
FT                   DTPPYNKQPIHQLPKEIKNQLITYYKIISPYMMDVNPDLNILLIDSFQGPESWSSYLKK
FT                   PWRWLRGTLPADHASFVLAQKEALQTLISKKKATQQFHIELNRDLIESVHKQTNLVLFP
FT                   YSEKTNVFLLDETKALNPANGATDKLKFRPEKGHNILVNPEDLTSEQALDLYQWYRNKR
FT                   EKFRVASKAYNEFITLLKKQTKTIAETEGRILHLNNLDKETKTRCRNLYNIFQPYFIDG
FT                   IPPELRASAISFDKFLVHSFSNESSTYDAPAVDLFEKLDEHFQIYFTEIDLQWGKKSNQ
FT                   YLKWAQEKFASENNSTELEHDEKLESRAHHLIKHTNFSKCIHEFRTELNQVISFFNNAM
FT                   RAQLKQQPNGIPYPELQDQNKELAQSEQVVAIKRIFNSLYHVEKIVVELEKLDTRSYES
FT                   IYVYHLIQAYDHINEIKKLALKLAVDPHFKLIASELLEKAQTLIATIQEHSDAYQVSPL
FT                   EVPYNQDIKYNALWYTLNAFYISPKHIRSLRNTNYLTTEELNDLHLKAKKATVTVENII
FT                   KSSNSYFKLFLQTPAMYSLYREMTNKLNEFISTSHDAVMNNLDQFRSKIFTPMLMEADA
FT                   WEDKLGLVPGTISGPLKTITDEYYKGLLHPLALHSKAHIRMICDKTPIDQRIKTTNKKL
FT                   ENATQHLDKIEKNYKHIIKLYEIIKTKGGKTTDDELIETYKKALYKLVKLQKRLPQNTD
FT                   HDPKDYELDTLLNSELKEYEPKLTLIKPLIISSYHHYEGLKATYLMKANTAREKLSYLK
FT                   ELRSTQEQEDLLYIEEYTTESFNKQLDAFCNRHIGLQYTDKEYRTKLREYLLTFKESII
FT                   QRSKSAEDINLTIKNLLKEKIKNFERDNFEKYYHLDAVRVALAQFKNYFSLSTAAIEQN
FT                   NSTFESEETLAKKTELINKLVDISEDGTLTPKERVDQISFHVKNPNFERIIMDYKQESY
FT                   FSFTYLKQCILSLLEALCLYTPERRKLFNNLESSVKTQPKINELTKRFGLFAGNESAIS
FT                   TESRAITPVSSVENNGTIELNQLAPST"
     MISEKIKLLE SFKQNQFSKL IEKINSKILA TLKSGHFNPR LAPYLEKMNK DGVPFTDFDL        60
     DPENISQIKK LINALYHARL AFLDLENIDI GNIKRTIPDL KLLYSNTIHQ AYQAGYLITN       120
     LDVDLQEMFK EEIDLILPVI GKLQAFAGEH QECTKHLAES LKDFPISYKA GEVTGIALEQ       180
     MQPRTGDWDY QFLTQFSAVL PGYIEKLTQY IQQYSSQIKE KEPTLNNEKL EELQNASLKL       240
     LNDLEHLKGN DFFISLKVLK YIHIIRNIIT LATSSVEQMG HFSDSSQDVI RDNLAQLKYV       300
     VLPTLFGLVD KIEDNAMLKP GTLSIPLMEK IKPLYQLLIY YASKPVNFKE KGEELLSIED       360
     SRFLALRLER TYQRIDEANK ALFKIQKAQE ALDNFYKILD TPPYNKQPIH QLPKEIKNQL       420
     ITYYKIISPY MMDVNPDLNI LLIDSFQGPE SWSSYLKKPW RWLRGTLPAD HASFVLAQKE       480
     ALQTLISKKK ATQQFHIELN RDLIESVHKQ TNLVLFPYSE KTNVFLLDET KALNPANGAT       540
     DKLKFRPEKG HNILVNPEDL TSEQALDLYQ WYRNKREKFR VASKAYNEFI TLLKKQTKTI       600
     AETEGRILHL NNLDKETKTR CRNLYNIFQP YFIDGIPPEL RASAISFDKF LVHSFSNESS       660
     TYDAPAVDLF EKLDEHFQIY FTEIDLQWGK KSNQYLKWAQ EKFASENNST ELEHDEKLES       720
     RAHHLIKHTN FSKCIHEFRT ELNQVISFFN NAMRAQLKQQ PNGIPYPELQ DQNKELAQSE       780
     QVVAIKRIFN SLYHVEKIVV ELEKLDTRSY ESIYVYHLIQ AYDHINEIKK LALKLAVDPH       840
     FKLIASELLE KAQTLIATIQ EHSDAYQVSP LEVPYNQDIK YNALWYTLNA FYISPKHIRS       900
     LRNTNYLTTE ELNDLHLKAK KATVTVENII KSSNSYFKLF LQTPAMYSLY REMTNKLNEF       960
     ISTSHDAVMN NLDQFRSKIF TPMLMEADAW EDKLGLVPGT ISGPLKTITD EYYKGLLHPL      1020
     ALHSKAHIRM ICDKTPIDQR IKTTNKKLEN ATQHLDKIEK NYKHIIKLYE IIKTKGGKTT      1080
     DDELIETYKK ALYKLVKLQK RLPQNTDHDP KDYELDTLLN SELKEYEPKL TLIKPLIISS      1140
     YHHYEGLKAT YLMKANTARE KLSYLKELRS TQEQEDLLYI EEYTTESFNK QLDAFCNRHI      1200
     GLQYTDKEYR TKLREYLLTF KESIIQRSKS AEDINLTIKN LLKEKIKNFE RDNFEKYYHL      1260
     DAVRVALAQF KNYFSLSTAA IEQNNSTFES EETLAKKTEL INKLVDISED GTLTPKERVD      1320
     QISFHVKNPN FERIIMDYKQ ESYFSFTYLK QCILSLLEAL CLYTPERRKL FNNLESSVKT      1380
     QPKINELTKR FGLFAGNESA ISTESRAITP VSSVENNGTI ELNQLAPST                  1429
//

If you have problems or comments...

PBIL Back to PBIL home page